KEGG   Staphylococcus epidermidis RP62A: SERP2203Help
Entry
SERP2203          CDS       T00229                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K19084  
bacitracin transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Two-component system
Module
Bacitracin transport system
Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2203
  Signal transduction
   02020 Two-component system
    SERP2203
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Bacitracin transporter [MD:M00731] [OT]
    SERP2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2237571..2239583)
Genome map
AA seq 670 aa AA seqDB search
MTFKILWKMIKQNFVNQRHIIVPFISVISILFGIEYILLSLTTNIYFNEHHPELKISAII
GIVFMTMLLFIFLIYANHFVMNHRKKEFALNMALGMEKKHLRLIILIELFIQFIISAILS
IVGGYLFGELFFMLFNKIVNTHQPQLSDYPFDVLSMKITLTMLLSLMIILFVINNFKISF
KNSLQLLIKNKSKTHEKSRVRLIIFLILGLIFIGIGYYLAIKPNTAIGSLGIIFFAILST
LIGTYLLFVSLGSIVLEMLQKLDHYYYKPNHFFFIAGLKSRVKSSAIGLATISFMCTFLI
VTLSMTVSTYRNMDHRFEFAFKNDYAGYYIGDFHKDSKIQRKIENLKKDIRQEVPTGQFK
IYARGMVGAELQGGLKHKKLKRQTVSSGLFNFGNKQKFNSFISIYNKSDYNKNNKKIKLD
DDEIAISTSVSLFKKMKTLNIFGKTYRVKYIESTNIDNLLYADGITLIVNQQQLMDRIVN
EYRNHNDENLIITPNQVQTAVEFNVLKEKDKLNHRIKKIGVQHDIEFQVKKQNLLMWKQV
NSSLVFVGSVVSLVLLIGIFLMMYYKQVSEGHEDRDAYITMKQLGLDEILIKKTINKQVI
WVFLIPVIVAIIHTLAAFRIIYSVLGIVGQYDLGLYATSYVGVIVVFIIFYSIMYWITSR
IYYTMINGKH
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaagattttgtggaaaatgattaaacaaaattttgttaatcaacgtcatatc
attgttccatttattagcgtaataagtattttattcggtattgaatacatattgttatcg
ttaacaaccaacatttactttaatgagcatcatcctgaattaaaaatatctgcgattatt
ggaatagtgtttatgacgatgttattattcatatttttaatttatgcaaatcactttgtt
atgaatcataggaaaaaggaatttgccttaaatatggctcttggtatggagaaaaaacat
ctaagactcatcatcttgattgaacttttcattcaatttattatatctgcaatcttgagc
attgttggaggttacttatttggtgagctcttttttatgttatttaataaaatagttaat
acgcatcaacctcagttgtcagattatccatttgatgttttgtcaatgaaaatcacatta
accatgctactcagtttgatgatcatattgtttgttattaacaattttaaaatatcattt
aaaaactccttacagttattgattaaaaataaaagtaagacgcatgaaaagtcacgtgta
cggttaataatatttttaattttaggattaatttttatagggattggctattatttagct
ataaaacctaacacggctatcggttccttggggattatattttttgcgattttgtcaacg
cttatcggtacctatttgctctttgttagcttaggatcaatagttttagaaatgttacaa
aaattagatcattattattataaacccaatcattttttctttattgcaggactcaaatca
cgcgtaaaatctagtgcgattggtttagctacgatttcatttatgtgtacatttctgatt
gttacgttaagtatgacagtctcaacttatagaaatatggatcataggtttgaatttgca
tttaaaaatgattacgcaggttattatattggtgattttcataaagatagcaaaattcaa
cgtaagatagaaaatttaaaaaaagatattcgccaagaagttccaactggtcaatttaaa
atctatgcacgaggtatggttggagcggaattgcagggaggcttaaaacataaaaagcta
aaaagacaaactgtatcgagtggtttatttaatttcggaaataagcaaaaattcaactct
tttatttctatatataataaaagtgattataataaaaacaataaaaaaataaaattagat
gatgatgaaattgcaataagtacaagtgtgtcattatttaaaaaaatgaaaacgctcaat
atatttgggaaaacatatagagttaaatatattgagtctacaaatatagataacttactc
tatgcagatggtataactttaattgtgaatcaacaacaactgatggatcgtatcgttaat
gaatatcgtaatcacaatgatgaaaatttaatcatcactcctaatcaagtccaaactgcc
gttgaatttaatgtattaaaagaaaaggataagttgaatcatcgtattaagaaaataggt
gttcaacacgatattgaatttcaagtgaaaaaacaaaacctattgatgtggaaacaagtc
aactcaagtttagtttttgttggaagtgttgtatctctagttttattgataggtatattt
cttatgatgtattataaacaagtttcagaaggacatgaagatagagatgcatatataacg
atgaaacaactaggattagatgaaattttaatcaaaaaaacaattaataaacaagtaata
tgggtatttctcattcctgtaattgttgcaatcatacatacgttagctgcttttcgcatc
atatactctgtattaggaatcgttggtcaatatgacttgggactgtatgctacaagttat
gtcggtgtgatagttgtatttattattttttattcaataatgtactggattacttctaga
atttattatacgatgataaacggtaagcattaa

DBGET integrated database retrieval system