KEGG   Staphylococcus epidermidis RP62A: SERP2208Help
Entry
SERP2208          CDS       T00229                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ser00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ser00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242520..2243989
Genome map
AA seq 489 aa AA seqDB search
MKFMNKMGKTTLASSIVAASVLSTVNVSYASGSSEQSAQTKQTQNDAIAFGNTKNPKNVI
FMVGDGMGPSFNTAYRYYKNKPGAKKMTPTAFDKYLKGTNRTYSNDPKENVTDSAAGGTA
FSTGHKTYNGAISVDTNKKPIKSVLEQAKEQGKSTGLVTTAELTDATPAVYAAHIDSRDK
KDEIAQQFYNDKINGKHKVDVMLGGGAKYFGKENKNLAKKFKKDGYDIVSNKDELNQSQS
KQVLGTFSEKDMPLQIDAPQSNPLLVDMQNSALNKLSKNNKGFFLMVEGASIDKAAHPND
ITGVMSEMSGFETAFDNAINYAKTHKDTLVVATADHSTGGLSTAKGKDYKWNPEAIHKMK
HSGMYMTKQIADGKDPEKVIKDGYGIDFPNKQLDKVKKAADELHKLQKEGKDDKDEKVVE
QTTKLQNAIQKPINDASHTGWTTNGHTGVDVNTYAYGPGSNKFKGNMENTQSAKNLFDFF
GDNVTSNQN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatgaacaaaatgggtaagacgacgcttgcttcatcaatcgtagcagcatcc
gttttaagtacggtaaacgtatcatatgcttcaggtagctcagaacaaagtgctcaaact
aagcaaacacaaaacgatgccattgctttcggcaacacaaaaaatccaaaaaatgtcatc
tttatggttggcgatggtatgggaccttcttttaacactgcatatcgctattataaaaat
aagcctggtgctaagaaaatgactccaactgcatttgataaatatctaaaaggaacaaat
cgtacttattctaatgatcctaaagaaaatgttacagactctgctgctggaggaacagct
tttagtaccggtcacaaaacatataacggtgcgattagtgttgatacaaataaaaaacca
attaaatctgtgctagaacaagctaaagaacaaggaaaatcaactggtttagtaactact
gctgaacttactgatgcaacacctgctgtatatgctgctcatatagattcacgcgacaaa
aaagatgaaattgcacagcaattttataatgataaaataaatggcaaacataaagtcgat
gtgatgttaggtggcggtgcaaaatacttcggtaaagaaaataaaaatttagcgaaaaaa
ttcaaaaaagatggttatgatatcgtttctaataaagatgaattaaatcaatcacaaagc
aagcaagttttaggtactttctcagaaaaagatatgccattacaaatagatgcacctcaa
tctaatccgttgctagtagacatgcaaaacagtgcactaaataaattaagtaaaaataat
aaaggattctttttaatggttgagggtgcttcaattgataaagctgcacaccctaatgat
atcactggtgtgatgtctgaaatgtctggtttcgaaacagcttttgataatgctattaat
tatgcaaagacacataaagatacacttgttgtagcaactgcagaccactcaactggtggt
ctatcaaccgcaaaaggtaaagattataaatggaatccagaggctattcacaagatgaaa
cattctggaatgtatatgacaaaacaaatcgctgatggaaaagatcctgaaaaagtaatt
aaagatggatacggcattgatttcccaaataaacaactcgataaagtcaaaaaagcagca
gacgagcttcacaaattacaaaaagaaggtaaagatgacaaagacgaaaaagttgtagaa
caaacaacaaaattacaaaatgcaattcaaaaaccaattaacgatgcttcacacacaggt
tggacaaccaatggccatacaggtgtagatgttaacacatatgcatatgggccaggttct
aacaaattcaaagggaatatggaaaatacccaaagcgctaaaaacttatttgactttttc
ggagacaatgtaacatcaaatcaaaattag

DBGET integrated database retrieval system