KEGG   Staphylococcus epidermidis RP62A: SERP2211Help
Entry
SERP2211          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2648 DUF3759 DUF3318
Motif
Other DBs
NCBI-ProteinID: AAW53044
UniProt: Q5HKX6
Position
complement(2248378..2248479)
Genome map
AA seq 33 aa AA seqDB search
MKKLAVILALAGAAFYGFKKYQNHVNQAPNIEY
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcagttattttagcattagctggtgcagcgttctatggtttcaaaaaa
taccaaaatcatgtaaaccaagctccaaacattgaatattaa

DBGET integrated database retrieval system