KEGG   Staphylococcus epidermidis RP62A: SERP2213Help
Entry
SERP2213          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2251501..2251632
Genome map
AA seq 43 aa AA seqDB search
MEKVKSYLKDIQNNEKYQKDIEFLEKKSNGREDRKFILDIFFL
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggttaaatcatatttaaaagacattcaaaacaacgaaaagtatcaaaaagat
atagaatttcttgaaaagaaaagtaatggaagggaagacagaaaatttatattagatata
ttctttttatag

DBGET integrated database retrieval system