KEGG   Staphylococcus epidermidis RP62A: SERP2215Help
Entry
SERP2215          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2252357..2252542
Genome map
AA seq 61 aa AA seqDB search
MSVKNIIKQSWEDLKNLELNFKNVSILVVVTFILSNIFTPLVGVPVGLLGSAYWIQNRKR
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaaaatataattaaacaatcttgggaagatcttaaaaatttagagttaaat
tttaagaatgtaagtattttggttgttgtaacatttatacttagtaatatttttactcca
ttagtcggcgttcctgtcggtttattaggcagtgcatattggattcaaaatagaaaaaga
aaataa

DBGET integrated database retrieval system