KEGG   Staphylococcus epidermidis RP62A: SERP2221Help
Entry
SERP2221          CDS       T00229                                 

Definition
(GenBank) cadmium resistance family protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2257793..2258410
Genome map
AA seq 205 aa AA seqDB search
MIQTIVTAAILYIATAVDLLVILLIFFARAKTRKEYRDIYIGQYVGSVTLIVVSLFFAFV
LNYVPEKWILGLLGLIPIYLGIKVAIYDDCEGEKRAKKELNEKGLSKLVGTVAIVTIASC
GADNIGLFVPYFVTLSVTDLLITLFVFLILIFFLVFTAQKLANIPGVGEIVEKFSRWIMA
VIYIALGLFIIIENDTIGTILGFIF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattcagactattgtaactgctgctattctttatattgcgacagcagtagatttatta
gtgattttattaatattttttgctagagcaaagactagaaaagaatatagagatatttat
attggtcaatatgtaggatctgtgacattgattgtcgtaagtttattctttgcctttgtc
ttaaattatgttcctgaaaaatggatattaggattattagggttaataccgatttattta
ggaattaaagtagctatttatgatgattgtgaaggagaaaagagagctaaaaaagaattg
aatgaaaaaggattgtctaaattagttggtacggttgcaattgttacgatagcaagttgt
ggtgctgataatattggtttatttgttccgtattttgtgacattaagtgttactgattta
ttaattactttgtttgtctttttaattttaattttcttcttggtatttactgcacaaaaa
ttagctaatattccaggagttggagaaattgttgagaaatttagtcgttggattatggct
gttatttacatagctttaggtttattcattattattgaaaatgacactattggaacaatt
ttaggatttatattttaa

DBGET integrated database retrieval system