KEGG   Staphylococcus epidermidis RP62A: SERP2227Help
Entry
SERP2227          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HB_MCP_1
Motif
Other DBs
NCBI-ProteinID: AAW53074
UniProt: Q5HKW1
Position
complement(2260680..2260847)
Genome map
AA seq 55 aa AA seqDB search
MKKKLPLVLSFVLAGLIVIGQTGFTQGSDYDQRMDNMMNECMNFMQSFDDNNENK
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagttacctttagtgctgtcgtttgtactagcaggtttaatagtcattgga
caaactggttttacccaaggttctgattatgaccagagaatggataatatgatgaatgaa
tgcatgaacttcatgcagtcctttgatgataacaacgaaaataagtag

DBGET integrated database retrieval system