KEGG   Staphylococcus epidermidis RP62A: SERP2250Help
Entry
SERP2250          CDS       T00229                                 

Gene name
arcA
Definition
(GenBank) arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00220  Arginine biosynthesis
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SERP2250 (arcA)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     SERP2250 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-ProteinID: AAW53094
UniProt: Q5HKU2
Position
complement(2277613..2278848)
Genome map
AA seq 411 aa AA seqDB search
MTNGPIQVNSEIGKLKTVLLKRPGKELENLVPDYLDGLLFDDIPFLKVAQQEHDHFAQVL
QDEGIEVLYLEKLAAQSIEDSNVREQFIDDVLAESRKTILGHEKEIKKLFSTLSNQALIN
KIMAGVRKEEIQLESTHLVEYMDDKYPFYLDPMPNLYFTRDPQASIGRGMTVNRMFWRAR
RRESIFISYILKHHPRFKDENIPLWVDRDCPFNIEGGDELVLSKDVLAIGISERTSAQAI
ERLARRIFKDPLSTFKKVVAIEIPTSRTFMHLDTVCTMIDYDKFTTHSAILKSEGNMNIF
IIEYDDKAEDIKIQHSSHLKQTLEEVLDVDEITLIPTGNGDIIDGAREQWNDGSNTLCIR
PGVVVTYDRNYVSNQLLREHGIKVIEIPGSELVRGRGGPRCMSQPLIREDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatggacctattcaagttaacagtgaaatcggcaaattaaagacggtattactt
aaaagaccagggaaggaattagaaaacttagtgcctgattacttagatggattattgttt
gatgatattccatttttaaaggtagctcaacaagagcatgatcattttgctcaagttctt
caagatgaaggaatagaagtgctttatttagaaaaattagcagcacaaagtatagaagat
tcaaatgtcagagagcaatttatagatgacgttttagcagaatctagaaaaactatccta
ggtcatgaaaaagaaataaaaaaactcttttcaactttgtcaaatcaagcattaattaat
aagattatggctggcgtacgcaaagaagaaatacaacttgaatcgacacatcttgtagag
tacatggatgataaatatccgttttatcttgacccaatgcctaatctatatttcacacgt
gatcctcaagcttcaattggtagaggtatgacagtaaatcgtatgttttggagagcgaga
cgcagagaatcgattttcatttcatatattttaaaacatcatcctagatttaaagatgag
aatattcctttatgggtggatcgtgactgtccgttcaacatcgaaggtggagacgaactg
gtgttatctaaagatgtacttgcaatagggatatctgaacgtacttctgcacaagcaatt
gaacgtttagcacgacgtatttttaaagatccgttatctacttttaaaaaggtggtggcg
attgagattccaactagtcgaacatttatgcacttagatactgtttgtacaatgattgat
tacgacaaattcactacacattcagcaattcttaaatcagaaggaaacatgaatatcttt
attatcgaatatgatgataaagctgaagatatcaaaatccaacattctagtcatcttaaa
caaacattagaagaagtgctcgatgttgatgaaatcacattaataccaactggaaatggt
gatatcatcgacggtgctcgtgaacaatggaatgatggttcgaatactttatgcatacgt
cccggtgtggttgtaacttatgatcgtaattatgtttctaatcaattgttacgtgagcat
ggtatcaaagttattgaaattcctggaagtgaacttgtacgtggtcgaggaggccctcga
tgtatgagtcaacctttaataagagaagatctatag

DBGET integrated database retrieval system