KEGG   Staphylococcus epidermidis RP62A: SERP2251Help
Entry
SERP2251          CDS       T00229                                 

Definition
(GenBank) transcriptional regulator, ArgR family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2279187..2279648)
Genome map
AA seq 153 aa AA seqDB search
MKKSKRQDLVTMIVKQNHIYKKADIIDYIDDHFGVRYSMTTIARDLRELHIYRLPVKANQ
YEYKLLTQQSQLDSRVRLNDYIETEIINTMIKESYILIKTTPGFAQSINYYIDQLQLKEI
IGTISGNDTIMILTHSQSIAEYVYYKIFNHNYS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtaaacgacaagatttagtaactatgattgttaagcaaaatcacatttat
aaaaaagcagatattattgattacattgatgatcactttggtgtacgttatagcatgact
actattgcgagagatttaagagaacttcatatttatcgcctgcctgtgaaggcaaatcaa
tatgaatacaaattacttacgcaacaatctcaattagactcaagagtaagactaaatgat
tatatagaaacagaaattattaacactatgattaaagaatcgtatatactaataaagacg
acaccaggatttgcacaaagcataaattattatattgatcagttacaactgaaagagatt
ataggaacgataagtggtaatgatacaattatgattcttacacattcccagtctatagct
gaatatgtctattacaaaatatttaatcataattattcataa

DBGET integrated database retrieval system