KEGG   Staphylococcus epidermidis RP62A: SERP2255Help
Entry
SERP2255          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1672 DUF1512
Motif
Other DBs
NCBI-ProteinID: AAW53107
UniProt: Q5HKT7
Position
2284405..2285319
Genome map
AA seq 304 aa AA seqDB search
MRKLIATIMVSSLILGGCSTVHEEENCASQSIPASQYKGQGFQPVAEKSAIAHAKKYREE
YEKLGEQFFKDNFSLNVKATNVVGSGDAVEVYVHCDDHDIVFNASIPFDMESIHEEGSMR
SIDNGDTMSDMVGTVLSGFEYRANKEKMDNLEKYLKDKEDKYHYTGFTDEAITKTQNIGY
QNNYFYITTSSTKLRDYRKHFEPLIKESDDDFKKHMKQLKSKKDTYINTEITTTLFSTLD
EYDEKIIRKNTLSMAKEMRKEPSIPHNFTFHLLFSNNKLKINDPNISNNQINEYRVFDHD
GFKN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactaatagccacaattatggtttcatcactaatattaggaggctgttcaaca
gtgcatgaagaagaaaattgtgcatcacaatcaattcccgcaagtcaatacaaaggtcaa
ggtttccaaccagtagctgaaaaaagtgctatcgcacatgcgaaaaaatatcgtgaagaa
tacgaaaaacttggcgaacaattttttaaagataattttagccttaatgttaaagccaca
aatgttgtaggaagtggtgatgccgtcgaagtctacgttcattgcgatgatcatgacatt
gtgtttaatgcaagcatcccttttgatatggaatcaatccatgaagaaggctccatgcga
agcattgataacggagatactatgagtgatatggtaggaactgtgttaagcggttttgag
tatagagcaaataaggaaaaaatggataacttagaaaaatacctcaaagataaagaagat
aaatatcactatactggattcaccgatgaagcaataactaaaactcaaaatataggttat
caaaataattacttttacattactactagttccacgaaattacgagattatagaaaacat
tttgaacctttaattaaagaaagtgacgatgattttaaaaagcatatgaaacaattaaag
tctaaaaaagatacgtatattaatacagaaataacgactacacttttcagtactctggac
gaatatgacgaaaaaatcattagaaaaaatactttatccatggctaaagaaatgagaaaa
gagccatctattccacataatttcacattccacttattatttagcaataacaaattaaaa
atcaacgatccaaacataagtaacaatcaaattaatgagtatagggtgttcgaccatgac
ggatttaaaaattaa

DBGET integrated database retrieval system