KEGG   Staphylococcus epidermidis RP62A: SERP2261Help
Entry
SERP2261          CDS       T00229                                 

Gene name
manA-2
Definition
(GenBank) mannose-6-phosphate isomerase, class I
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00051  Fructose and mannose metabolism
ser00520  Amino sugar and nucleotide sugar metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SERP2261 (manA-2)
   00520 Amino sugar and nucleotide sugar metabolism
    SERP2261 (manA-2)
Enzymes [BR:ser01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     SERP2261 (manA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: AAW53113
UniProt: Q5HKT1
Position
2291376..2292326
Genome map
AA seq 316 aa AA seqDB search
MVLFLQPVFQERLWGGTNLTQFGYDIPNNSTGECWAISAHKNGPNTILNGKHKGKSLKQV
WDEDKALFGNDSRKDFPLLTKILDAHDCLSVQVHPDDEYALKHEGEYGKTECWYILDAQP
GAEIIYGVNATSKNELEHMIDHHQFDYLFKHVPVKPGDFFYVPAGTVHAIGSGILILETQ
QSSDTTYRIYDYDRKDKNGHTRELHLNQSKDVIDITTTEPNTTPKTEMINGNCHTQFVAN
HFFTVEEWSIKDILDFQKPHTYCLVSMINGHGQVSINNKVYKIDKGDHFILTSEDQYIKF
VGNMDLIVSFSKDEAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtactttttcttcaacccgtatttcaagaacgtttatggggtggcaccaatctcact
caatttggctacgatattccgaataattctaccggcgaatgctgggcaatttccgcacat
aaaaacggtcctaacacaattctcaacggaaaacataaggggaaatctttaaaacaagtt
tgggacgaagataaagcacttttcggaaatgactcacgtaaagattttccacttctcact
aaaattttagatgcacatgattgtttgtcagtacaagtacatcctgatgatgaatatgcg
cttaaacatgaaggcgaatacggtaaaactgaatgttggtatattttagacgctcaacct
ggtgctgaaataatctatggtgttaatgctacaagtaaaaatgaacttgaacatatgatt
gatcatcatcaattcgactatttatttaaacatgtacctgttaaaccgggtgatttcttt
tatgtaccagccggtacagttcatgctattggttccggaatcctcattttggaaactcaa
caatcttcagatacaacatatcgtatatacgattatgacagaaaagataaaaatggtcat
acgcgtgaattacatttaaaccaaagtaaagatgttattgatatcactacaactgaacct
aatacaacacctaagactgaaatgataaatggcaattgtcacactcaatttgttgccaat
catttctttacggttgaagaatggtctatcaaagacatattagattttcaaaaaccacac
acttattgcctagtgtcaatgattaacggccacgggcaagtttcaatcaataacaaagta
tataaaatcgataagggcgatcattttattttaacttctgaagatcaatatattaaattt
gttggtaatatggatttaatagtcagttttagtaaagatgaggcatattaa

DBGET integrated database retrieval system