KEGG   Staphylococcus epidermidis RP62A: SERP2263Help
Entry
SERP2263          CDS       T00229                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase domain protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2295783..2297750
Genome map
AA seq 655 aa AA seqDB search
MKKNKFLVYLLSTALITPTFATQTAFAEDSSNKNTNSDKMEQHQSQKETSKQSEKDEFNN
DDSKHDSDDKKSTSDSKDKDSNKPLSADSTHRNYKMKDDNLVDQLYDNFKSQSVDFSKYW
EPNKYEDSFSLTSLIQNLFDFDSDITDYEQPQKTSHSSNDEKDQVDQADQAKQPSQHQEP
SQSSAKQDQEPSNDEKEKTTNHQADSDVSDLLGEMDKEDQEGENVDTNKNQSSSEQQQTQ
ANDDSSERNKKYSSITDSALDSILDEYSQDAKKTEKDYNKSKNTSHTKTSQSDNADKNPQ
LPTDDELKHQSKPAQSFEDDIKRSNTRSTSLFQQLPELDNGDLSSDSFNVVDSQDTRDFI
QSIAKDAHQIGKDQDIYASVMIAQAILESDSGKSSLAQSPNHNLFGIKGDYKGQSVTFNT
LEADSSNHMFSIQAGFRKYPSTKQSLEDYADLIKHGIDGNPSIYKPTWKSEALSYKDATS
HLSRSYATDPNYSKKLNSIIKHYHLTSFDKEKMPNMKKYNKSIGTDVSGNDFKPFTETSG
TSPYPHGQCTWYVYHRMNQFDASISGDLGDAHNWNNRAESEGYTVTHTPKNHTAVVFEAG
QLGADTQYGHVAFVEKVNDDGSIVISESNVKGLGVISFRTIDAGDAQDLDYIKGK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaataaatttttagtatatttactatcgacggcgcttatcacgccaaccttc
gctacacaaacagcttttgctgaagattcatctaataaaaatacaaattcagataaaatg
gaacaacatcaatcacaaaaagaaacatcaaaacaatctgaaaaagatgaatttaacaac
gatgattctaaacacgattctgatgataaaaaaagcacttctgacagcaaggacaaagac
tctaataaaccattatcagctgattcaacacatcgtaactataaaatgaaagatgataat
ttagttgatcaactttatgataattttaagtctcagtcagtagatttttctaaatactgg
gaaccgaataaatacgaagacagttttagtttaacgtcactcatccaaaatttatttgat
tttgattctgatataacagattacgaacagccacaaaagacaagccattcttctaatgac
gaaaaagatcaagtagaccaagcagatcaggcaaaacaaccatcacaacatcaagaacca
tcacagtcgtctgctaaacaagatcaagaaccatcaaacgatgaaaaagaaaagacaact
aaccaccaagccgattctgacgtcagtgatttacttggagaaatggataaagaagatcaa
gaaggcgaaaacgtagatacaaacaaaaatcaatcttcttctgagcaacaacaaactcaa
gcgaatgatgatagctcagaacgtaacaaaaaatattctagtattacagattcagcatta
gactctatattagatgaatatagtcaggacgctaagaaaacagaaaaagattacaataag
agcaagaatacaagtcacactaaaacatctcaaagtgataatgccgacaaaaatccacaa
ttaccaacagatgatgaattaaaacatcaatcaaaacctgcacaatcatttgaggatgac
attaaacgctcaaatacacgttcaacaagtcttttccaacaactacctgaattagacaat
ggtgacttatcttctgattcatttaatgttgttgacagtcaagacacacgtgatttcatt
caatcaattgctaaagatgcgcatcagattggaaaagaccaagatatatatgcatcagtt
atgattgctcaagctattttagaatctgactctggaaaaagttcacttgcacaatcacca
aatcataacttgtttggaatcaaaggtgactacaaaggacaatctgtaacttttaatact
ttagaagctgatagcagtaatcatatgtttagtatccaagcaggtttccgtaaataccca
agtactaaacaatctcttgaagattatgcagatttaatcaaacatggtatcgatggtaat
ccgtcaatttataaaccaacttggaagagtgaagctctatcatataaagatgctacttca
catctgtcacgctcatacgccacagatcctaattattctaaaaaattaaatagtattatt
aaacattatcatttaacatcttttgacaaagaaaaaatgcctaacatgaagaaatataat
aaatcaataggtacggatgtgtctggtaatgacttcaaaccatttactgaaacttccggt
acatcaccttacccacatggccaatgtacttggtatgtgtaccaccgtatgaatcaattt
gatgcatccatttctggtgacttaggtgatgctcataattggaataaccgtgctgaaagt
gaaggctatacggtaacgcacacacctaaaaatcatactgcagttgtgtttgaagctggg
caattaggtgctgatacacagtatggtcatgttgccttcgttgaaaaagttaatgacgac
ggttcaattgttatttctgaatcaaatgttaaaggattaggtgtcatttcattcagaact
attgatgcaggagatgctcaagatttagattacattaaaggtaaatag

DBGET integrated database retrieval system