KEGG   Staphylococcus epidermidis RP62A: SERP2274Help
Entry
SERP2274          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAW53143
UniProt: Q5HKR8
Position
complement(2306039..2307379)
Genome map
AA seq 446 aa AA seqDB search
MINLFENYNQETQELHQSLKRAGYNHFTIVINDDGFLPDDVTSPYRFFTAYQIYEDDTPA
FFNDIDTPPFWEIKGDATMATITDMGELRGKIFYKEHYKTRVVSHVEWLDSKQRLRSVDY
YTKEGFKFAETVYDLLGNAILKKYMTREGKEVIYENYVTNDVVVEYEGKSYFFESYTEWI
KFYLSEMGIEIKEVIFNTLSTPFLAIYHLPTLKKGILFWQEQSQGYVPGNMKVMLSPNLQ
SRFAVIVPNQNEYKLIKEQLSREEQQAVYASGYLYDTYKRNHYSKNVLTLTNSDQIPHVE
TLVRLHKDYQFHIGAKTEMSSKLLSLSQYENVKLYPIIKEQTVQTLYQQCDIYLDINEGN
EIGNAVRSAYNHQLLIMGYKEVVHNQDFVAIENQFLVNDISQLSNALKEIGNHRGQFETR
LALQQRHANAVPVSTFKYALVQALSG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttattcgaaaattataatcaagaaacacaggaattacatcaatctcttaag
cgtgctggttacaatcactttacgattgtaattaatgatgatggatttttacctgatgat
gtgacatcgccgtatcgttttttcacagcatatcaaatttatgaagatgatacccctgct
ttttttaatgatattgatacgccgcctttttgggaaattaaaggagatgcgacaatggct
accattacagatatgggtgagcttagaggtaaaatcttttataaggaacattataagaca
cgtgtagttagccatgtagagtggcttgattcaaaacagcgtttgcgttcggttgattat
tatacaaaagaaggatttaaatttgctgaaacagtttacgatttgttaggtaatgcaata
ttaaaaaagtatatgacacgtgaaggtaaagaagtgatttatgagaattatgtaactaac
gatgtagttgtagaatatgaagggaaatcttatttttttgagtcatatacagagtggatt
aaattttacttgagtgaaatgggcattgagataaaagaagttatatttaatactttatca
acaccatttttagcaatttatcatttgccgacattgaaaaaaggtattttattttggcaa
gaacaatctcagggttatgtcccaggaaatatgaaagtcatgttatcaccaaaccttcaa
agtcgctttgccgttattgtccctaatcagaatgaatacaaattgatcaaggaacaacta
tctagggaggaacaacaggcagtatatgcatctggttacttatatgacacgtataaacgg
aatcattattctaagaatgtattaacattaacaaattcagatcaaataccacatgttgaa
acgttggtacgtttgcataaagattatcaatttcacataggcgctaaaactgagatgtct
tcaaaattattaagtttatcgcaatatgaaaatgttaaattatatccaataattaaagaa
caaacagttcaaaccttatatcaacaatgtgacatctatttagatattaatgaggggaac
gaaatagggaatgctgtaagaagcgcatataatcatcaattgttaattatgggatataaa
gaggttgttcataatcaagatttcgttgcaatagaaaatcagtttcttgtaaatgatata
agtcagttgagtaacgctttgaaagagataggaaatcatcgtggtcaatttgaaacacgt
ttagcactacaacaacgtcatgctaatgctgtgccggtatcaacatttaaatacgcatta
gtacaagcattaagtggttaa

DBGET integrated database retrieval system