KEGG   Staphylococcus epidermidis RP62A: SERP2305Help
Entry
SERP2305          CDS       T00229                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ser01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ser00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2344562..2345806)
Genome map
AA seq 414 aa AA seqDB search
MLSAQQFLKEFNNVESLDESLYEIVSQICEEVKLQGDKALKNYNLQFDQVETEKLELEQS
QLKNAYDMLDNETRDALEQSYQRIKVYQENIKVKQESSQQTECYERYHPIERVGIYVPGG
KASYPSTVLMTATLAQVAGVNEITVVTPPQNSGICQEVLAACYITGVHHVYQVGGAQSIA
ALTYGTETIKKVDKIVGPGNQYVAYAKKFVFGQVGIDQIAGPTEIALIIDESADLDAIAY
DVFAQAEHDEMACTYVISENEKVLNQLNTIIQEKLQYVERQDIISQSIANHHYLILAQDT
EEACLIMNTIAPEHASIQTRAPEMYIDKVKYVGALFLGHFSPEVIGDYVAGPSHVLPTNQ
TARFTNGLSVNDFMTRHSVIHLSQKTFNEVAESAEHIAHIESLFNHEKSIHVRR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcgcacaacaatttttaaaagaatttaataatgttgaatctctagatgaatct
ttgtacgagatagtgagtcagatttgtgaagaagttaaattacagggagataaagcttta
aaaaattataatttacaatttgatcaagtggaaactgagaagcttgaattagagcaaagc
caactaaaaaatgcatacgacatgctagataatgaaacacgagatgcattagagcaaagc
tatcagagaattaaagtgtaccaagaaaatattaaggtaaaacaggaatcatctcaacaa
actgaatgttatgaacgataccatcctatcgaacgtgtaggtatttatgtgccgggaggt
aaggctagctatccgtctacagtattaatgactgcaacacttgctcaagtagcaggtgtt
aatgagattactgttgttaccccacctcaaaatagcggtatatgtcaagaggtgttagcc
gcttgttacattacaggcgttcatcatgtttatcaagtcggtggagcacaaagtattgcg
gcgctaacttatggcacggaaactataaaaaaagtcgacaaaatcgtaggtccagggaat
caatatgttgcttatgccaaaaagtttgtattcggtcaagtaggcatagaccaaatcgca
ggaccgacagaaatagccttgattatagacgaaagtgctgacttagacgcaatcgcttat
gacgtatttgcacaagcagaacatgatgaaatggcttgtacttatgtgattagtgaaaat
gaaaaggtacttaatcaattgaacactataatacaagagaaacttcagtatgttgaacgg
caagatatcatatcacaaagtattgctaaccatcattatctaatattagctcaagatact
gaagaagcatgtttaattatgaacacgattgcacctgaacatgcatctattcaaactcga
gcacctgaaatgtatatagataaagttaaatatgtaggcgcactttttttaggtcatttt
tctcctgaagttattggggactatgtggcaggtccaagtcatgtacttcctactaatcaa
acagctagatttacaaatgggctttctgtgaatgactttatgacacgacattcagtcatt
catttatcacaaaaaacatttaacgaagtggcagaatcagctgagcatattgcacatata
gaatctttatttaatcatgaaaaatcgattcacgtacgccgataa

DBGET integrated database retrieval system