KEGG   Staphylococcus epidermidis RP62A: SERP2324Help
Entry
SERP2324          CDS       T00229                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP2324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2324
   00020 Citrate cycle (TCA cycle)
    SERP2324
   00620 Pyruvate metabolism
    SERP2324
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SERP2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360269..2361546)
Genome map
AA seq 425 aa AA seqDB search
MSENIIMPKLGMTMKEGTVEEWFKSEGDTVKQGESIVTISSEKLTNDVEAPASGTLLEIK
VQAGEDAEVKAVLGIIGEEGEAIDKDEDDLASEKVKEDNEHEKETQEVKDTSQQSSDNKD
NSPKSAARERIFISPLARNMAEDKGLDINKIKGTGGNHRITKLDIQRVEANGYDYASDTT
SNEDTSHVPTQTVDTSAIGEGLNPMRQRIAQNMRQSLNSTAQLTLHRKVDADRLLDFKDR
LATELKQADQDVKLTVTTLLAKAVVLALKEYGAMNARYEQGELTEYEDVHLGIATSLDEG
LMVPVINHADTKSIGTLAHEIKSSAEAVREGNTGAVQLEGATFTITNMGASGIEYFTPIL
NLGETGILGVGALTKEVVLEADNIKQVSKIPLSLTFDHQILDGAGAADFLKVLAKYIENP
YLLML
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaatattattatgccaaagcttggaatgacaatgaaagagggaactgttgaa
gagtggtttaaatcagagggtgacaccgtaaaacaaggagagagtattgttacaataagc
tctgaaaaattaaccaacgatgttgaagcgccggcgagtgggacattgttagaaattaaa
gtgcaagccggagaagatgcagaggttaaagcggtattaggtataattggagaagaaggg
gaagctattgataaagatgaagatgatttagcatcagaaaaagtaaaagaagacaacgag
catgagaaggaaacgcaagaagttaaagatacatcacaacagtcttccgataataaagat
aattcgcctaaaagcgcagcacgagaaagaatctttatctcacccctcgcacgtaatatg
gctgaggataaaggattagacattaacaagataaaaggcacaggcggtaatcatcgtatt
acaaaactagatattcaacgtgttgaagcaaatgggtacgactatgctagtgatacgaca
tctaatgaagatacaagtcatgttccaacacagactgtggatacaagtgcgattggtgaa
ggattgaatcctatgcgtcaacgtattgctcaaaacatgagacaaagtcttaatagtact
gctcaattaacattacatcgtaaggttgatgcggatcgcttgctagatttcaaagacaga
ttagctacggaacttaaacaagcagatcaagatgttaaattaactgttactacattatta
gctaaagcagtagtgcttgcacttaaagaatatggggcaatgaatgctcgctatgaacaa
ggcgagttaactgagtatgaagatgttcatttaggaatcgcaacgtctctagatgaaggc
cttatggtgccagtgattaatcatgcagatacaaaaagtatcggcactttagcccatgaa
attaaatcatcggctgaggctgttcgggaaggaaacacaggagcagtacaattagaggga
gcaacatttacaattactaatatgggtgctagtggtatagaatactttacaccaatttta
aatttaggtgaaacaggtattctaggcgttggtgctttaactaaagaagtcgtgctagaa
gcggataacattaaacaagtttcaaaaattcctttaagcttgacatttgatcatcaaatt
ttagatggtgcaggtgcggccgattttcttaaagtactagctaaatatatcgaaaaccct
tatttattaatgttatag

  All links  
No link information was found.   
DBGET integrated database retrieval system