KEGG   Serratia sp. ATCC 39006: Ser39006_005025Help
Entry
Ser39006_005025   CDS       T05290                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sera  Serratia sp. ATCC 39006
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sera00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ser39006_005025
   00500 Starch and sucrose metabolism
    Ser39006_005025
Enzymes [BR:sera01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Ser39006_005025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1070217..1071626)
Genome map
AA seq 469 aa AA seqDB search
MKEIHLLKQIVHALMSGQSRQTYDPYRPYWHLSPSVGLLNDPNGFVQHKGRYHLFYQWNP
FACAHGAKCWGHWSSTDLVHWRHEPVALVPGESYESHGCYSGSAVVENDALVLIYTGNVK
YEDGSRTAYQCLARENTDGEFDKLGPVLTLPEGYTGHVRDPKVWRHNNDWYMVLGAQSKD
LQGKVLLYRSDDLHIWHSLGEIAGSGLGGLDNFGYMWECPDLFTIDQHDVLVCCPQGLVA
EEERYLNTFQSGYFIGKLDYETGDFPHQEFHELDNGFEFYAPQTTLSHDGRRLLFGWMGI
PDQNEFHQPTLSHGWIHTMTCPRELTLHEGRLFQQPARELQILRNQQHIWQGVANYAPVL
PASSAELMLDSQGEFQLNFTDLMVLCWDGERLTLNRRNLRSGEPEHRYWHGNLSHLQILC
DRSSIEIFINHGEAVMSARYFPTRDATVTFSGPGRLTLQHWLLAPCVIE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatccacttattaaaacagatagttcatgctctgatgtcaggccaatcccgc
cagacatacgacccataccgtccatactggcacttgtcaccaagcgtcggattgctcaat
gatccaaatggatttgtacagcacaaagggcgttatcatctgttttatcagtggaatcct
ttcgcttgtgctcatggtgccaagtgctggggacactggagttctactgacctggttcat
tggcgtcacgaacccgtggcgttggtgccaggggaaagctatgaaagccacggttgttac
tccggttccgccgtggtggagaacgatgctctggtgctgatctacaccggtaatgtcaaa
tatgaggatggatcacgtactgcctaccagtgtctggcgcgagaaaataccgatggcgag
tttgataaactcggcccggtgttaacactgccggaaggctataccgggcatgtccgtgac
ccaaaagtctggcgccacaataacgattggtacatggtgcttggggcgcaaagtaaagat
ttacagggaaaagtgctcctttatcgctctgacgatctgcatatctggcactctctgggt
gaaattgccggttccggtctgggcggcctggacaactttggttatatgtgggaatgcccg
gaccttttcactatcgatcaacacgatgtactggtttgctgtccacaagggcttgtcgcg
gaagaagaacgctacctgaatacctttcagtcgggatatttcatcggcaaactggattat
gaaactggtgatttcccgcatcaggagttccacgagctagataacggctttgagttttac
gcgccccagaccacgctcagtcacgatgggcgtcgtctgctgtttggttggatgggtatc
cccgatcagaatgagttccatcaacccacactttcccacggctggatccataccatgacc
tgcccacgggaactgacattgcatgaagggcggctgtttcagcagcccgcccgggagctg
caaattctgcgtaaccagcaacacatctggcaaggtgtagcaaattacgcaccggtacta
cccgccagtagtgccgagctgatgctagactcgcagggagagtttcagctcaactttact
gacttgatggtgctgtgttgggacggagaacgactgaccctcaaccgccgtaatctgcgc
agcggcgaaccagagcaccgttattggcacggcaacctgagtcatttacagatcctctgt
gatcgctccagcatagagatctttatcaaccacggtgaagccgtgatgtccgctcgctat
tttcccacccgcgacgccaccgttacatttagcggtcccggtaggttgacgctccagcac
tggttgttagcgccatgcgtgatagaatga

DBGET integrated database retrieval system