KEGG   Serratia sp. FS14: L085_18255Help
Entry
L085_18255        CDS       T03313                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
serf  Serratia sp. FS14
Pathway
serf00052  Galactose metabolism
serf00500  Starch and sucrose metabolism
serf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    L085_18255
   00500 Starch and sucrose metabolism
    L085_18255
Enzymes [BR:serf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     L085_18255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIA49062
Position
3986346..3987788
Genome map
AA seq 480 aa AA seqDB search
MNTALAQADHAVEALRAERRDDYYPQFHLAPPAGWINDPNGLICIDGVYHAFFQHHPYSE
HWGPMHWGHATSRDLIRWQHQPIALAPDASYDQDGCFSGCAVDDNGVLTLIYTGHVWLGE
PGDDSQVREVQCLATSEDGLRFVKHGPVLAPPDGIQHFRDPKVWRENGEWWLVVGAKENG
LGQVRLYRSADLRAWRFDRVLAGAQTAHQGYMWECPDFFPLGEQHLLLFSPQGLAAQGYR
YRNRFQSGYLLGHWRPDGDFTVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHRWAGALTLPRELTLAADGSVRMNPARELAALRRESHSFLAQTLTNQHLPLANDV
QELTLTLRPADNDAERYGLAIGSAARLFVDNQAHRLVLERFHENPALSTCRSVPLPEGDI
LSLRIFIDRSSLEIFVNQGLACLTSRIYPTEEDRRLSLFAEGGRAEFEPITGWQLASIWG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccttagctcaagccgaccatgcggtcgaggccctgcgcgcagagcgccga
gatgattactacccgcagttccatctcgcgccgcccgccggctggatcaacgatcccaac
ggcctgatctgtattgacggcgtctatcatgcgttcttccagcatcacccctacagcgaa
cactgggggcccatgcactgggggcacgcgaccagccgcgatctgatccgctggcagcac
cagcccatcgccctggcacccgatgcgtcctatgaccaagacggttgtttttccggctgc
gccgtggatgacaacggcgtgctgacgctgatttacaccggccacgtgtggctgggcgag
cccggcgacgacagccaggtgcgggaagtgcaatgtctggccaccagcgaagacggctta
cgcttcgtcaagcacgggccggtgctggccccgccggacggcattcagcatttccgcgat
ccgaaagtctggcgcgagaacggcgaatggtggctggtggtcggcgctaaagaaaacggc
ctgggccaggtacgcctgtaccgttctgcagacctgcgcgcctggcgcttcgatcgggtg
ctggctggcgcgcaaacggcgcatcaagggtatatgtgggaatgcccggatttcttcccg
ttgggggaacaacacctgctgctgttctcgccgcagggcctggcggcgcagggctaccgc
taccgcaatcgcttccagagcggctatctgctcggccattggcggccggacggcgacttt
acggtaacgcagcccttctgcgagctggatgccggccacgatttctatgcgccgcagacc
ttcaccgccgccgatggccgccggctgctgtttgcctggatggatatgtgggaatcaccg
atgcccagcaaagcgcaccgttgggccggcgccctcaccctaccgcgcgagctgacgctg
gccgccgacggcagcgttcgcatgaacccggcgcgtgaactggcggcgctgcgccgagaa
tcgcactcgtttttggcgcagacgctcaccaatcagcatttgccgctggcgaacgatgtg
caggaactcactctgacattgagaccggccgacaacgacgccgagcgttacgggctggcc
atcgggagtgcagcgcggctgttcgtcgataatcaggcgcaccgactggtactggaacgt
tttcatgaaaaccccgccctgagcacctgccgcagcgtgccgctgccggagggtgacatc
ctgtcgctgcggatctttatcgaccgttcatcgctggagattttcgttaatcagggattg
gcctgcctgaccagccgcatttatccgacggaggaggatcgccgcctcagcctgtttgcc
gagggcggacgggcagagttcgaacccatcacaggatggcagttggctagcatctgggga
tag

DBGET integrated database retrieval system