KEGG   Serratia sp. ATCC 39006: Ser39006_0507Help
Entry
Ser39006_0507     CDS       T02836                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
serr  Serratia sp. ATCC 39006
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:serr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ser39006_0507
Enzymes [BR:serr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ser39006_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
550480..551406
Genome map
AA seq 308 aa AA seqDB search
MKSGKLVVLGSINADHILNLEQFPRPGETVIGKQYGVAFGGKGANQAVAAGRSGAVISFI
ACVGDDDMGTRIRQQLASDNIDVSAVEKISGETTGVALIFVNGEAENMIGIHAGANAAVT
PAYLKLYQQKIIDASALLMQLESPLETVTAAARLAHEQGTQVILNPAPACHLPDELLSLV
DIITPNETEAQILTGVAVETEEDAQRAARVLHDKGIKTVLITLGSRGVWLSEQGLGQRIP
GFRVKAVDTIAAGDTFNGALVTALLEKQPMVTAVRFAHAAAAIAVTRYGAQPSVPWREEI
DAFLQAQG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggcaagctggtagtattgggcagtatcaatgcggaccatattctgaatctc
gagcagtttccccggccgggtgaaacggtgatcggtaagcaatatggtgtggcatttggt
ggtaaaggcgccaatcaggctgtagctgccggacgcagtggagcagttatctcttttatc
gcctgcgtgggtgatgatgatatgggtactcgcattcgtcagcagcttgccagcgacaat
attgatgtttctgccgtagaaaagatatctggagagacgacaggtgtcgcgctgattttc
gttaatggcgaagctgagaatatgatcggtattcatgccggagccaacgctgccgtcaca
ccagcgtacctcaagttgtatcagcaaaaaatcattgatgcatcggcgttgttaatgcag
ttggaatctccgttggaaaccgttactgccgctgccaggctggcacatgaacagggaacg
caggttattcttaaccccgcgcctgcctgtcatcttccagacgagttgttatcgctggtg
gatattattacgcctaatgaaactgaagcgcagatcctgactggtgttgctgttgaaacg
gaagaagacgctcagcgagctgcccgggtattgcacgataaaggtattaaaacggtacta
atcacattaggaagtcgtggcgtctggttgagcgaacaggggctgggacaacgtattcct
ggttttcgcgtgaaagcggttgatactatcgccgctggtgatacgttcaacggtgcgttg
gtgactgcgttactggaaaaacagccgatggtgactgcggtgaggtttgctcatgctgcc
gccgctattgccgtgacgcgttatggcgcacaaccttcagtaccatggcgtgaagagatc
gatgctttcttgcaagcacaggggtga

DBGET integrated database retrieval system