KEGG   Serratia sp. ATCC 39006: Ser39006_2072Help
Entry
Ser39006_2072     CDS       T02836                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.22)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
serr  Serratia sp. ATCC 39006
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:serr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ser39006_2072
   00650 Butanoate metabolism
    Ser39006_2072
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ser39006_2072
   00280 Valine, leucine and isoleucine degradation
    Ser39006_2072
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ser39006_2072
Enzymes [BR:serr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ser39006_2072
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Ser39006_2072
Amino acid related enzymes [BR:serr01007]
 Aminotransferase (transaminase)
  Class III
   Ser39006_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2321630..2322946
Genome map
AA seq 438 aa AA seqDB search
MQKFMAEQQVFADNTLLLDSRAEHIPRGVVTAHPLVIAKGKGAEVWDIEGNRYLDFVAGI
GVLNVGHNHPAVVSAVQQQLQQVSHVCFQVAAYPGYIELARRLNQLMGSDVAYKSIFFTS
GAEAVENAVKIARAYTGRSGVIAFDGAFHGRTSLGIALTGMSQPYKQNFGPFPGDIYRVP
FPNTFHGITEITCLAALESLFVAQIQAERVAAIIIEPIQGDGGFLPASPHFMQALRQLTQ
QHGIVLICDEIQSGFGRTGKMFGYEHSGIVPDLITVAKSLGGGLPISGVIGRGDIMDAAL
PGGLGGTYGGNALACAAALAVLDLMEEGTLLVRANTLGQQLRARLQQLAEKYACIGDVRG
TGFMLAAEIVDPDSRKPDAALTQKILDYACQEGLLLIKCGVYRNTIRFLAPLVTSDSQLE
EASHIFDIALARASGRLG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatttatggctgaacagcaggtatttgctgataacaccctgttactggattcc
cgcgcagagcatatcccgcgtggtgtcgtcaccgcacatccattggttatcgccaaaggc
aaaggggctgaggtctgggatattgaaggtaatcgttatctcgattttgtcgccggaatc
ggcgtcctgaatgtgggccataatcacccggcggtagtgtctgcggtacagcaacagctc
cagcaggtttctcatgtctgtttccaggtggcggcgtatcccggttacattgaattggcg
cggcgactgaatcagttgatgggcagcgacgtggcgtataaaagcatattttttaccagc
ggtgccgaagctgtggaaaatgcggtgaaaatagcccgagcctataccgggcgcagtggt
gtgatagcttttgacggcgcttttcatggccgtacatcgctaggtattgcgctcaccggc
atgagtcagccctacaaacagaatttcggcccgttcccgggagatatctatcgggttcca
tttcccaataccttccatggcatcactgaaattacctgtctggcggcgctggaatcgctg
tttgtagcacaaattcaggcggagcgggtcgcagcgataattatcgaaccgatacaaggg
gacggtggttttttgcccgcatcaccccattttatgcaggcgctgcggcaattaacccag
cagcacggcatcgtattgatttgtgatgagatccagagtggttttggccgcaccggaaaa
atgtttggttatgagcacagcggcatcgtgcctgatctgatcacggttgccaaaagtctt
ggcggcggattaccgatttctggggtgattggtcgcggcgatataatggatgccgctctg
ccaggcgggttgggcggtacttatggtggtaacgccctggcctgcgctgctgcgctggcg
gtgttggatctgatggaagaagggacgttgctggttcgggcaaatacgctggggcagcaa
ctgcgggccagattgcagcaactggcggaaaagtatgcctgcatcggtgacgtgcgcggc
acgggctttatgctggctgccgaaatagtcgatccagatagccgtaaaccggatgctgca
ttgacgcagaaaattctggattatgcctgtcaggaagggctgttactgattaaatgcggg
gtataccgtaataccatccgttttctggcaccgctggtcaccagtgattcgcaactggaa
gaagcctcgcatatctttgatattgcactggctcgtgcctcgggacgcttgggatag

DBGET integrated database retrieval system