KEGG   Serratia sp. ATCC 39006: Ser39006_2188Help
Entry
Ser39006_2188     CDS       T02836                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
serr  Serratia sp. ATCC 39006
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ser39006_2188
   00500 Starch and sucrose metabolism
    Ser39006_2188
Enzymes [BR:serr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Ser39006_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2450502..2451824)
Genome map
AA seq 440 aa AA seqDB search
MSLTRFPLAATAVSVSLLLAACSNSQPHDTVKPLSPGTATRPVLSAQEAEPFTLQHYLAA
TGLYTQPQADGWFPAAVNTGNIATPYVVGPKAGTDGATYTHIQQAVNAAIRQSKNNQRVY
IRVLPGTYTGTVYIPADAPPMTLSGAGSQPGQVVIQLALDSMISPTTYRSTVNAGQEYQP
SDPAWYMYDVCASKQKATIDTICAAVMWSQSDDFQLKNLTVMNSLLDKIGSGTHQGVALR
TDGDKVQLENVRLIGRQDTFFVNTSNRKNEYVTDHYSRAYIKDSYIEGDVDYVFGRATAV
FDNVHFHTVSSRGSRGAYVFAPDTMPRVKYGFLVIHSKLTGDSGFRGTLKAKLGRAWDQG
ASKTGYLPGNTANGQLVIRDSTIDSSYDQLNPWGAAATTNRPFHGNISPTRNLNDVKFNR
LWEYNNVVMTGHSTGLPTAK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgactcgttttcccctcgcggcaacagcggtgtcggtatccctgctactcgct
gcctgtagcaattcgcaaccacatgacaccgttaaaccgctatctccgggaacagctacc
cgcccggtgctttccgctcaggaagctgagccgtttactctacaacactatcttgccgcc
accggtctttacactcagccacaagctgacggttggttccccgctgcggtgaataccggc
aatatagcaacaccttacgtcgtcggaccgaaagccgggacagacggcgccacatatacc
catattcaacaggcagtcaatgccgcgattcgacagtcaaaaaacaatcaacgtgtgtat
atcagagtgttgccgggtacttataccggtacagtttatatccctgcggatgccccgccg
atgacgctatctggtgccggttcacagcccggccaggtagttattcagttggcgctcgac
tcgatgatttctcccaccacctaccgttctacggtcaacgctggtcaggaatatcagccc
agcgatcccgcctggtatatgtatgacgtctgtgcatccaagcagaaagccaccatcgat
accatctgtgctgccgtcatgtggtcccagagtgatgattttcagcttaaaaacctgact
gtcatgaactcactgctggataaaataggcagtggcacacaccagggcgttgcgctgcgg
actgacggcgacaaagtacagttggaaaacgtgcgcttgattggtcgtcaggatacgttc
ttcgtcaacaccagcaacaggaagaatgaatatgtcaccgatcactatagccgcgcctat
atcaaggacagttacattgaaggcgatgtggattatgtgtttggccgcgccacggcagtt
ttcgataatgttcatttccatactgtttccagccgtggatcacgtggcgcctacgtgttc
gcgcccgataccatgccgcgggtgaaatatggttttctggtaatacacagtaaactcact
ggcgatagcggctttcggggcacactgaaagcaaaactgggacgcgcctgggatcaaggg
gcgagtaaaaccggctatctgccaggcaacactgccaacgggcagttggtgattcgtgac
agtacgattgacagcagctatgaccaactcaacccgtggggcgcggcagccaccaccaac
cggccatttcacggcaacatcagcccgaccagaaacctgaatgatgtgaaattcaaccgg
ttgtgggagtacaacaatgtggtgatgactggacatagcaccggattaccgaccgcaaaa
taa

DBGET integrated database retrieval system