KEGG   Serratia sp. ATCC 39006: Ser39006_2615Help
Entry
Ser39006_2615     CDS       T02836                                 

Definition
glycoside hydrolase family 24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
serr  Serratia sp. ATCC 39006
Brite
Enzymes [BR:serr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Ser39006_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2888065..2888595
Genome map
AA seq 176 aa AA seqDB search
MTNVKKAGGAVGVVCSVMTIIAIVVSNGQVRTNERGLELIGNAESCRRDPYVCPAGILTD
GIGNTHGVVDGTRKTDAQIAADWQKNILDAERCVDRYANGKKLPDGAFSAASSIAFNAGC
PMMQKSTMFQLFRAGNIHAACEQFPRWVYGGNKKLPGLVVRRDKERALCLSSQAGK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgttaagaaagcgggtggtgccgttggtgtagtgtgttccgtaatgacaata
attgccatcgtggtttctaacggacaggttcgtacaaatgaacgtgggttagagttgatc
ggcaatgctgaatcctgtcgtcgtgatccgtatgtctgtccagctggcattctcactgat
ggaatcggaaacactcacggcgtggtagatggaacccgtaaaacagacgcgcaaatcgct
gcagactggcagaaaaacattctcgacgctgaacgctgcgttgacagatacgcaaacgga
aaaaagttgccagatggtgcgttcagcgctgcctcaagtatcgcttttaatgccggttgc
ccgatgatgcaaaaatcaacgatgttccagttattccgggccggaaatattcatgcggcg
tgtgagcagttcccgcgttgggtatacggcggcaataaaaaattgccggggctggtggtt
cgtcgggataaggagcgtgcgttatgtctatcctcccaggctggaaagtaa

DBGET integrated database retrieval system