KEGG   Serratia sp. ATCC 39006: Ser39006_2932Help
Entry
Ser39006_2932     CDS       T02836                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
serr  Serratia sp. ATCC 39006
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:serr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ser39006_2932
   00650 Butanoate metabolism
    Ser39006_2932
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ser39006_2932
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ser39006_2932
Enzymes [BR:serr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ser39006_2932
Amino acid related enzymes [BR:serr01007]
 Aminotransferase (transaminase)
  Class III
   Ser39006_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3229639..3230904)
Genome map
AA seq 421 aa AA seqDB search
MNNSELNQRRLAATPRGVGVMCDFFAAKAENATLWDVEGHEYIDFSAGIAVLNTGHRHPK
ILAAVREQLECFTHTAYQVVPYGSYITLAERINAIAPIHGPAKTTFFTTGAEAVENAVKI
ARAYTKRPGVIAFNAAFHGRTLLTMTLTGKVAPYSTGFGPFPGSIFHAVYPSEHNGVTVE
QSLENIDRLLHTDIAADQVAAILLEPVQGEGGFNVAPPEFISALRKLCDEHGILLIADEV
QSGFARTGKVFAMEYYEEKADLITMAKSLGGGFPISGVVGRADVMDAPGPGGLGGTYAGN
PLAVASALAVLDVIEDEKLCQRAQQLGATLVETLRSLKAKCPAIVDIRARGSMVAVEFND
PQTGKPSAEITKTFQKEALNQGLLLLTCGVHGNVIRFLYPLTIPDAQFSKALDILTRVLT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagcgaattaaatcaacgccgtttggccgccacgccgcgtggtgtaggggta
atgtgtgatttctttgctgccaaggcggagaatgccacgttgtgggatgtggaaggccat
gaatatattgatttttctgctgggattgcagtgctgaacactggccatcgccatccgaaa
attctggctgcagtgcgtgaacagctggagtgttttactcacaccgcttatcaggttgtg
ccttatggcagctatatcacgctggccgaacgtatcaatgcgatagcgcctatccacggg
ccggcaaaaaccactttcttcacgacgggtgctgaagctgttgaaaatgcagtgaaaatt
gcgcgtgcttataccaaacgccctggtgtgattgcctttaacgctgcttttcatggccgt
acattgctgaccatgacattgactggcaaagtggcaccttattccactggttttggccca
ttcccagggtccatttttcacgcggtatatcctagcgagcataatggcgtcacggtagaa
cagtcgctggaaaatatcgatcgtttgctgcataccgatattgctgctgatcaggtggcg
gctattctgctggaaccggtacagggtgaaggcggtttcaatgtggcgccaccggaattc
atcagcgcactgcgtaaactgtgtgatgagcacggcatattgttgattgccgatgaagta
caaagcggttttgcccgtactggcaaagtgtttgcgatggagtattacgaagaaaaagcg
gatctgatcaccatggcgaaaagcctggggggcggtttcccgatttccggcgtggttggt
cgcgctgacgtgatggatgccccaggaccgggcggactgggtggcacctatgctggtaac
cccctggcggtggcgtcagctctggcggtactggatgtgattgaagacgaaaaactgtgc
cagcgtgcgcagcaactgggagccacactggtagagacgctgagaagtctgaaagcgaag
tgcccggcgatcgtcgatattcgtgcccgtggctcaatggtggcggtagaattcaatgat
ccgcaaacgggtaaacctagtgcggagattaccaagacattccaaaaagaggcgctgaat
caggggctgctgctgctgacatgtggtgtgcatggcaacgtgatccgtttcctgtacccg
ctgaccattcctgatgctcagttcagtaaagcattggacatcctgacccgcgtcctgact
cagtaa

DBGET integrated database retrieval system