KEGG   Serratia sp. ATCC 39006: Ser39006_3724Help
Entry
Ser39006_3724     CDS       T02836                                 

Definition
penicillin-binding protein 1B (EC:2.4.1.129)
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
serr  Serratia sp. ATCC 39006
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:serr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ser39006_3724
Enzymes [BR:serr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Ser39006_3724
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     Ser39006_3724
Glycosyltransferases [BR:serr01003]
 Polysaccharide
  Bacterial polysaccharide
   Ser39006_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4174913..4177414)
Genome map
AA seq 833 aa AA seqDB search
MSRDDREPIGRKGNTSRRKPTRKQTVRRHRDDDYDDDYDEYDDDYDNDDDGDGDGDDNGK
NMTRKPRKKRRWLGLMIKLSLIFAVVIAVYGIYLDSEIRSRIDGKVWQLPAAVYGRMVNL
EPGMAYSKKEMVNLLEGMQYRDVNRITRPGEFTVQANSIEMLRRPFDFPDGKEGQIHAKL
IFSNDRLSQIQNMDNQRNFGFFRLDPKLITMLQSPNGEQRLFVPRAGFPDLLVDTLIATE
DRHFYEHDGISLYSIGRALVANLIAGHTVQGGSTLTQQLVKNLFLTNKRSLWRKANEAYM
ALIMDHRYSKDRILELYLNEVYLGQSGNDQIRGFPLASLYYFGRPVDELSLDQQAMLVGM
VKGASLYNPWRNPKLTLERRNLVLRLLQDQKIIDEELYNLLSARPLGVQPKGGVISPQPA
FMQLVRQELQQRLGDRANDLSGVKIFTTLDPVAQDAAEKAVETGIPALRAARNVKDLETA
MVIVDRFSGEIRAMVGGADTQYAGFNRALQARRPVGSLAKPPTYLTALSMPDKYRLNTIL
DDEPLSIKLSNGTVWEPRNYDRDYGGQVMLVDALARSLNIPTVNLGMAVGLDKISATLQL
LGIPKSVIQPVPAMLLGSISLTPMEVAQEYQTIASGGNRAPLSSLRSVIAEDGTVLYQSF
PQAERVVPAQAAYLTLYGMQQVVERGTARSLMAKFSKYHLAAKTGTTNDLRDSWFAGIDG
KEVAITWVGRDNNGPAKLTGANGALTIYRRYLENETPLPLMLTPPEGISSMTVDSSGNFI
CNGSSAGQVIPVWTSNPQALCQSSQTTHPAPVSAQPDQGSDSVPGWIKQMFGK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggatgatcgcgaacctatcggacgcaaaggaaatacgtcacgacgaaaacct
acacgtaagcagacggtacgacgtcacagggatgacgactatgatgatgattacgacgag
tacgatgatgattacgataatgacgacgatggtgatggtgatggtgatgataacgggaaa
aacatgacacgcaaacctcgtaagaagcggcgctggctggggcttatgatcaaactgtcc
ctgatctttgctgtagtgatagccgtctacggtatttatctggatagcgaaatccgcagt
cgtattgatggcaaggtttggcagttgcctgccgctgtttatggtcgcatggtcaacctt
gaacccggtatggcctacagcaaaaaagagatggtcaatctgctggagggtatgcagtat
cgagatgtcaaccggattactcgtcctggtgagtttactgttcaggcaaacagcatcgag
atgttgcgtcgtccttttgatttccccgatggcaaagaaggacagatccacgccaagctg
atattcagcaatgatcggttgtcgcaaatccagaatatggataatcagcgtaatttcggg
ttcttccgtctcgatccgaagttgatcaccatgttgcagtcgccaaatggggagcaacgc
ctatttgtgccgcgagctggtttccctgatctattggtggatacgctgattgccaccgaa
gaccggcatttttatgagcatgatggtatcagcttgtattccatcggacgtgcgttggtg
gccaatctaatcgccggccatacggtgcaagggggaagtaccctgacccagcagttggtg
aaaaacctgtttctgaccaacaagcgttcgctgtggcgtaaggcaaatgaagcctatatg
gcgttgattatggatcaccgctacagcaaagatcgtattctggagttgtatcttaacgaa
gtttatctgggacaaagcggtaacgatcagattcgagggttcccgctggcgagcctgtat
tactttggccgtccggtggatgaactaagccttgaccagcaggccatgctggtgggcatg
gtgaaaggggcgtcattgtataacccctggcgcaacccaaaattgacgcttgaacgtcgt
aatctggtactacgtctgttgcaggatcagaagattattgatgaggagctctacaatctg
ctgagcgctcgtccgttgggtgtccagccgaaaggcggcgttattagcccgcaaccggct
tttatgcagttggtccgccaggagctacagcagcgactcggggatcgtgctaatgatctt
tctggcgtgaaaatttttactacgcttgatcccgtcgctcaggatgcggcagagaaagcg
gtggaaacgggcattccggcgctgagagcggcccgtaatgtgaaagatctagaaacggca
atggtgattgtcgaccgtttcagcggtgagattcgggcgatggttgggggcgctgacacc
cagtatgccggctttaaccgtgccttgcaggccaggcgtccggtggggtcgttggcgaaa
ccgccgacctatctgacggcattaagcatgccggataaataccgactcaatactattctg
gatgatgaaccgctatccattaagctttcgaatggcacggtatgggaaccaagaaattac
gatcgggattacggtggtcaggtgatgttggttgatgctctggcacgatcgctcaatata
ccgacggtaaatcttggtatggcggttggtctggataagataagcgctaccctacagctg
ctggggattccaaaaagtgtgattcagcctgttccggcgatgttattgggctctatcagc
ctgacaccaatggaagttgctcaggaatatcagacgattgccagcggtggtaatcgtgcg
ccattgtcatcgttgcgttcagtgatcgcagaagatggcactgtgctttatcagagcttt
ccgcaggcggaaagagtggtaccggcacaagctgcatatctgacgttgtatggtatgcaa
caggttgtggaacgtggcacggctcgctcgttgatggcgaagttcagtaaataccatctg
gcagccaaaacagggacaactaatgatttgcgtgacagctggtttgccggcatcgatggt
aaagaggtggcaattacctgggttggacgtgataacaacggtccggccaagttgacgggg
gctaacggtgcgttgactatctatcgccgttatctggaaaatgagacgccgttgccgctg
atgctgactccgcctgaaggtattagcagcatgacagtggacagcagcggtaacttcatt
tgtaacggcagcagtgccgggcaggtaataccggtgtggacgagcaatccgcaggcgtta
tgtcagtccagccaaacaacacacccagcacccgtcagtgcgcaaccagaccaaggcagt
gacagtgttcctggctggataaaacagatgtttgggaagtaa

DBGET integrated database retrieval system