KEGG   Salmonella enterica subsp. arizonae: SARI_00481Help
Entry
SARI_00481        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00010  Glycolysis / Gluconeogenesis
ses00052  Galactose metabolism
ses00500  Starch and sucrose metabolism
ses00520  Amino sugar and nucleotide sugar metabolism
ses00521  Streptomycin biosynthesis
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
Module
ses_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ses_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_00481
   00052 Galactose metabolism
    SARI_00481
   00500 Starch and sucrose metabolism
    SARI_00481
   00520 Amino sugar and nucleotide sugar metabolism
    SARI_00481
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SARI_00481
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SARI_00481
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SARI_00481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ABX20410
UniProt: A9MIH3
Position
481435..482400
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITARALADSCIDCRRALSLFCVI
MGRFGGDLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHSIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattctggtctggactatcccagc
cttgaggctgtggtgcgcgtttatctcgatgagcatagcgtcagcgtagaggatggctgt
atcgccatcgcctgtccgattaccggcgactgggtggcgatgacaaaccatacctgggca
ttttctattgcggaaatgaaaaaaaatctcggctttagtcatctggagattatcaatgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacccatcgcggtgtatggcgcgggaaccgggcttggg
gtagcgcatctggtgcatgtggataagcgctggattagcctgccgggcgaaggcgggcat
gtcgattttgcgcctaacagcgaagaagaagccatgattctggaaatactgcgcgccgaa
attggccacgtttccgccgagcgcgttttgtctggccctgggctggtgaatctttaccgg
gcgattgttaaatccgataatcgtctgccggaaaatctgcgcccgaaagatattaccgcg
cgcgccttggcggatagctgtattgattgtcgccgcgcgttgtcgctcttttgcgtcatt
atgggccgatttggcggcgatctggcgttaaccctggggacgtttggcggggtttatatc
gcaggcggcattgtcccgcgtttcctggaattctttaaagcctccggcttccggggcggt
tttgaagataaaggtcgttttaaagattatgtgcatagtattccggtttatctgattgtc
catgataatcctggattgctgggctccggcgcgcatctgcgtcagacattaggccatatt
ttataa

DBGET integrated database retrieval system