KEGG   Salmonella enterica subsp. arizonae: SARI_00699Help
Entry
SARI_00699        CDS       T00627                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ses00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
719342..720010
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatcttgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgtcgacgagattttcgctggcctcgac
tatgccaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcacttcgtgaccattgatggc
aaagcgaccgtcgcgtatatccccaaagattccgtgatcggcctgtcgaaaattaaccgc
atcgtgcaattcttcgcccagcgtccccaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacgtcgctg
ggcggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgtcat
catccatga

DBGET integrated database retrieval system