KEGG   Salmonella enterica subsp. arizonae: SARI_00984Help
Entry
SARI_00984        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SARI_00984
Enzymes [BR:ses01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SARI_00984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
965466..966551
Genome map
AA seq 361 aa AA seqDB search
MSANGGAFIGAFFISGVSTCIIKRIHYNTIGGLMPLHHLTRFPRLEFIGAPTPLEYLPRL
SDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLVTAGAIQSNHVRQTAAV
AAKLGLHCVALLENPIGTAAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIE
AQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLE
HLMPDIELIGVTVSRSVSGQKPKVVALQQAIAGKLALTATADIHLWDDYFAPGYGVPNDA
GMEAVKLLARLEGVLLDPVYTGKAMAGLIDGISQKRFKDEGPILFIHTGGAPALFAYHPH
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaaacggaggcgcgttcatcggtgccttttttatttccggcgtatcaacgtgc
ataataaaaagaatacactacaacactatcggaggcttaatgccgctacatcacttaacg
cgctttccacgtctggagtttatcggcgcacctaccccgctcgaatacctgccgcgattg
tcggattatcttgggcgtgagatttacattaagcgcgatgacgttacgcctattgcgatg
ggcggcaataaactgcgcaagctggagtttctggtggccgacgcgctgcgggaaggagca
gatacgttggtaacagccggggcgattcagtcgaaccatgtccgtcagacggcggcggtc
gcggccaaactgggactgcattgtgtcgccttgctggaaaatccaatcggcaccgccgca
gaaaattacctgacgaatggtaatcgcctgttactggatttatttaatacgcaaattgaa
atgtgcgatgcgctaaccgatccggacgcgcagcttcaaacgctggcgacgcgtattgaa
gcgcaagggttcaggccatatgtaattcctgtcggcggctccagcgcgctgggcgcaatg
ggatacgtagaaagcgccctggaaatcgcgcagcagtgtgaagaggtcgtaggactctct
tcggtggtggtggcctccggtagcgccggaacgcacgccgggttagccgttggactggaa
cacctgatgcctgacatcgaactgattggtgtgaccgtttcacgttctgtctccgggcag
aaaccaaaagtggtggccttgcagcaggctattgccggtaagctggcgctgaccgcgacg
gcggatattcatttatgggatgactattttgccccaggttacggcgtgccgaatgacgcg
gggatggaggcggtgaaactgctggctcgcctggagggggtgctgctggacccggtatat
accggcaaagcgatggcgggtttgatagacggcatcagccagaaacgttttaaagatgaa
gggccaattctctttattcacaccggtggggcgcctgctctgtttgcctaccatcctcat
gtgtaa

DBGET integrated database retrieval system