KEGG   Salmonella enterica subsp. arizonae: SARI_01051Help
Entry
SARI_01051        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ses00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SARI_01051
Enzymes [BR:ses01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SARI_01051
DNA repair and recombination proteins [BR:ses03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SARI_01051
    RecFOR pathway proteins
     SARI_01051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_3 HHH_8
Motif
Other DBs
NCBI-ProteinID: ABX20959
UniProt: A9MND6
Position
1022950..1023636
Genome map
AA seq 228 aa AA seqDB search
MRLDIYPAFFYDTTLPFQPFTQERHVIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCF
YELPESGKEAIIFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSA
QQFVNAVEREDPAALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAVDLVLMSPASPT
SEDAEQEAVAALVALGYKPQEASRMVSKVAHSDASSETLIRDALRAAL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggatatctatccagcctttttttatgatacgactttaccttttcagcccttt
acgcaggagcgtcatgtgataggcagactcagaggcattattctcgaaaaacaacccccg
atcgtactgctggaaacagggggcgtaggctacgaagtgcatatgccgatgacctgtttc
tatgagctcccggaatccggaaaggaagcgataatctttacccattttgtggtgcgtgaa
gatgcgcaattgctgtacggattcaacaataagcaagagcgcacgctgtttaaagagctg
atcaaaacgaatggcgtcgggcctaagctggcgttggctatcctctccggcatgtcggcg
cagcagttcgtcaatgcggttgaacgtgaagatcctgcggcgctggtaaaattacccggc
atcggtaaaaaaaccgccgaacgattgattgtggaaatgaaagaccgctttaaagggcta
catggcgatctctttacgccagcggtcgatcttgtattaatgtcgccagccagtccaacc
tcggaagatgctgaacaagaagcggttgctgcgttggtggcgctgggttataaaccgcaa
gaagccagtcggatggtgagcaaagtcgcccattctgacgcaagcagtgaaacactgatt
cgcgacgcgttacgcgccgcgttatga

DBGET integrated database retrieval system