KEGG   Salmonella enterica subsp. arizonae: SARI_01201Help
Entry
SARI_01201        CDS       T00627                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SARI_01201
   00052 Galactose metabolism
    SARI_01201
   00500 Starch and sucrose metabolism
    SARI_01201
   00520 Amino sugar and nucleotide sugar metabolism
    SARI_01201
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SARI_01201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1166098..1167006
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAYPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVEDVTAYGV
VNCKGIELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattcaaaagtcaaaaaagccgttatcccggtcgcgggactgggaacc
aggatgctgccagcgaccaaagcgatcccgaaagagatgttgccgctggttgataagcca
ttaattcagtacgtcgtgaacgaatgtatcgctgctggcattactgaaattgtgcttgtt
actcattcttctaaaaattccattgaaaaccactttgataccagttttgaattggaagca
atgctggaaaaacgcgttaagcgtcagctactggaagaagttcagtctatttgccccccg
catgtcactattatgcaggtacgtcaggggttggcaaaaggcttgggtcatgccgtattg
tgcgcgtatcctgtagtcggaaacgaacctgtcgccgttattctgccagacgttattctt
gacgaatatgagtccgatctgtctcaggataacctggctgaaatgatccgccgtttcgac
gaaactggaaatagtcagattatggttgagccagtagaagatgtgacggcttacggcgtt
gtaaattgcaaaggcattgagctggcgccaggtgaaagcgtacctatggttggtgtagtt
gaaaaaccaaaagcggatgtcgcgccttctaaccttgcgattgtcggacgttatgtactg
agcgcggatatctgggcattattagcgaaaactcctccgggtgccggggatgaaattcag
ttgaccgatgctattgatatgctgatcgaaaaagaaacggttgaagcctaccacatgaag
ggcaaaagccatgactgtggtaataagctgggatatatgcaggcatttgttgaatatggc
atccgtcataattctctgggtgctgaatttaaagcctggcttgaagaagaaatgggtatt
aagaagtaa

DBGET integrated database retrieval system