KEGG   Salmonella enterica subsp. arizonae: SARI_01229Help
Entry
SARI_01229        CDS       T00627                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SARI_01229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SARI_01229
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SARI_01229
Enzymes [BR:ses01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SARI_01229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1190473..1191666)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAQVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKSQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDASVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAHLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALK
MMREHPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaatccctactttggtgaattcggcggcatgtatgtgccgcagatt
ctgatgcctgcgctgagacagcttgaagaggccttcgtcagcgcgcaaaaagatcctgaa
tttcaggcgcaattcgccgatctgctaaaaaactacgcgggacgccccaccgcgctgacg
aaatgccagaacattaccgccggtacgcgtaccacgttgtatttaaagcgcgaagattta
ctgcacggcggcgcgcacaaaaccaatcaggtactgggccaggcgctgctggccaaacgg
atgggtaaaagcgagattatcgctgaaaccggcgccggtcagcacggcgtcgcctctgcg
ctcgccagcgccctgctgggtctgaaatgccgtatctatatgggcgccaaagacgttgag
cgccagtcgccgaacgtcttccgtatgcgtctgatgggcgctcaggttatcccggttcat
agcggctccgctacgctaaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctcggcacggcggcaggcccgcacccgtatccaacgatt
gtacgcgagtttcaacgcatgattggcgaagagacgaaatcgcaaatcctcgacaaagaa
ggccgtctgcctgacgccgttatcgcttgcgtcggcggcgggtcaaacgctatcgggatg
tttgcggattttattaatgacgccagcgttgggttaattggcgttgaacctggcggccac
ggtattgaaaccggcgagcatggcgcgccgcttaaacatggtcgcgttggcatctatttc
gggatgaaagcgccgatgatgcaaacagcggacgggcaaattgaagagtcatattccatt
tccgccgggctcgatttcccgtctgttggaccgcaacatgcgcacctgaacagcatcgga
cgggcggattacgtctccattaccgatgacgaagcgctggaggcattcaaaactctgtgc
cgccatgaaggaattatcccggccctggagtcttctcacgcgttggcgcacgctctgaaa
atgatgcgcgagcacccggaaaaagagcaactgctggtggtcaacctttctggccgcggc
gataaagacatctttaccgtacacgatatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system