KEGG   Salmonella enterica subsp. arizonae: SARI_01284Help
Entry
SARI_01284        CDS       T00627                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ses00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1238652..1240340
Genome map
AA seq 562 aa AA seqDB search
MKVNQKIEKYLSEIYGKTFTPRHYEALNSRIEKARLLISKKRKTHWDERDVVLITYADQF
HSDTSKPLPTFNKFHRQWLAATFSHLHLLPFCPWSSDDGFSVVDYYQVAPETGDWEDISD
LSQSSQLMFDFVCNHMSAKSEWFNHYLQQAPGFENFFIAVDPSTDLSAVTRPRALPLLTP
FTLKDKSVHHLWTTFSDDQIDLNYRCPDVLLAMVDVLLTYLEKGADYIRLDAVGFMWKIP
GTTCIHLPQTHLLIKLFRAITDDVAPGTVIITETNVPHKDNIAYLGNGEDEAHMVYQFSL
PPLVLHAVHGQDVRALCSWAQSLTLPSENTTWFNFLASHDGIGLNPLRGLLPEDEILKLV
EDLQQEGALVNWKNNPDGSRSPYEINVTYMDALSDRYSTDDQRLARFILAHAILLSFPGV
PAIYIQSILGSRNDYDGVTQLGYNRAINRKKYRRTEIEAELMDETTLRYRVYHALSRLIE
IRRNNKAFHPESQFSIKNISPCVMQIERVAKTGESIVALFNVSDNINTINSKKFQGTDLI
SETNLTGEVLTLHPWQVLWIKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaatcaaaaaatcgagaaatacctgtcagaaatctatggaaagacatttacg
ccacgacattacgaggcgctgaactcacgcattgaaaaagcacgattattaatttcaaaa
aagcgtaaaacgcactgggacgaaagggatgtggtgctcattacttacgctgaccagttt
cacagtgatacatcaaagccgttaccaacatttaataaatttcatcgacaatggctggcg
gctactttttctcatctccatctattacctttttgtccgtggtcttcggatgacggtttt
tcagtcgtagattattatcaggtcgcacctgaaacgggcgattgggaagatatcagtgat
ctcagccagagcagtcaacttatgtttgactttgtttgcaatcatatgtcggcaaagagt
gagtggttcaaccattatttgcaacaagcgcctggctttgaaaatttctttattgccgta
gacccatcaaccgatcttagcgcagtcacccgaccacgcgccttaccgttgctcacgcca
tttaccctgaaggacaagtctgttcatcatctatggacaaccttcagcgatgaccagatt
gatctcaactatcgttgtccggatgttttgctggcgatggtcgatgtactgctgacttat
ttagagaaaggggctgattatatccgtctggacgcggtagggtttatgtggaaaataccg
ggtaccacctgtattcatttaccacagacacatctgctgattaagctctttcgcgctatt
acggatgacgtcgcgccaggtacggtcattattactgagaccaatgttccgcataaagac
aacattgcatatctggggaacggcgaagatgaagcgcatatggtctatcagttttcactg
ccgccgctggtgcttcatgccgttcacggccaggatgtacgcgcgctgtgttcatgggcg
caatctttgacgcttccctcagaaaatacgacctggttcaatttccttgcgtctcatgac
ggtattgggcttaatccattacgcggtcttttgccggaagacgagatactgaagctggta
gaggacttacaacaagaaggcgcgctggttaactggaaaaataacccggacggtagccga
agcccttatgaaataaacgtgacgtatatggatgcgcttagcgatcgatatagtactgac
gatcaacgcctcgccagatttattctggctcacgccattttactctcttttccaggcgtg
ccggcgatatatatacaaagtattctgggttcccgtaacgattatgacggcgtgacacaa
ctggggtataaccgggcgattaatagaaagaaataccggcgcacagaaattgaagcggaa
ttaatggatgagacaacgttaagatatcgcgtctatcatgccttatccagacttatcgag
attcggcgaaataataaagcttttcatccagaaagccaattttccattaaaaatatatca
ccttgtgttatgcaaatagagagagtggcaaaaacgggagagtccattgtcgctttgttt
aatgtcagcgataacataaataccattaatagtaaaaagtttcagggtactgatttaatt
agcgaaacgaatctcaccggcgaggtattaacgctacacccctggcaggttctgtggatt
aaaaaataa

DBGET integrated database retrieval system