KEGG   Salmonella enterica subsp. arizonae: SARI_01462Help
Entry
SARI_01462        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SARI_01462
   00220 Arginine biosynthesis
    SARI_01462
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SARI_01462
Enzymes [BR:ses01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SARI_01462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1421568..1422548
Genome map
AA seq 326 aa AA seqDB search
MLSAILAGLFRPASKEHVVARAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLG
IAICTVDGQHYQAGDAHERFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLV
QLEMEQGIPRNPFINAGALVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEF
EHSARNAAIAWLMKSFGNFHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLD
EPVVTPMQARQINALMATNGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPE
LDPAGNSLAGIAALEQLTQTLGRSVY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctgctatactcgcaggccttttcagacctgcgagcaaggagcatgttgtggcc
agggccatggataatgcaattttagagacgattttacagcgcgttcgccccctcattggc
cagggcaaagtcgctgactatattccggccttagcgtccgtcgagggttcaaagctggga
atagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttc
tctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattatccagaa
gaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcgctggtt
cagttagagatggaacaaggtatcccgcgtaatccatttattaatgcgggcgcgctggtg
gtatgcgacatgttgcaaggacggcttagcgcgccgcgtcagcggatgctggaagttgtg
cgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgctcgctctgaattt
gagcattccgcccgtaacgccgctattgcgtggctgatgaaatcattcggtaattttcat
catgatgtgcctaccgtgttgcaaaattacttccattactgtgcgttgaaaatgagctgt
atggaactggcgaggacgtttgtttttctggcgaatcagggcgaggcatttcatctcgac
gagccggtagttacgcccatgcaggcccggcagattaacgcgctaatggcgaccaacggc
atgtatcagaacgccggggagtttgcctggcgagtgggattgcccgctaagtccggagtg
ggaggggggattgtcgctattgtaccgcatgaaatggcgattgccgtctggagtcctgaa
ctggaccctgcagggaattctctggcgggtattgccgcgcttgaacaattaacacagaca
ttaggacgctcagtatactga

DBGET integrated database retrieval system