KEGG   Salmonella enterica subsp. arizonae: SARI_01686Help
Entry
SARI_01686        CDS       T00627                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SARI_01686
Enzymes [BR:ses01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SARI_01686
    3.5.1.-  
     SARI_01686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1627118..1627774
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVPEGDSTIDIANRLIDWCQPRQIPVLASQDWHPVGHGS
FASQHQAEPYSQGELDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDATIYKGENPLIDSY
SAFFDNEHRQKTTLDAWLREHDVTELIVLGLATDYCVKFTVLDALQLGYAVNVITDGCRG
VNIQPQDSAHAFMEMAAAGATLYTLADWEETQGQVVAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttactactggtcgacttacagaatgatttctgcgctggcggcgca
ctggctgtgccggaaggcgacagcactatcgacatcgccaaccggcttattgactggtgc
cagccccgccagattccggtgctcgccagccaggactggcatcccgtcgggcatggcagt
ttcgccagtcagcatcaggcggaaccctatagtcagggagaactggacggtctgccgcaa
acgctctggccggatcactgtgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgatgctaccatttataagggtgaaaacccgctgattgacagttat
agcgcgttttttgacaacgaacatcggcagaaaacaacccttgatgcctggcttcgcgag
catgacgtcaccgagcttatcgtgctggggttggctaccgattactgcgtaaaatttacg
gtactggatgcattacagttaggctatgctgttaacgttattaccgatggctgccgcggc
gtgaatattcagccacaggatagcgcgcacgcgtttatggagatggcggcggcaggcgca
acactgtataccctggcagactgggaagaaacgcagggccaggttgtcgccaaataa

DBGET integrated database retrieval system