KEGG   Salmonella enterica subsp. arizonae: SARI_02141Help
Entry
SARI_02141        CDS       T00627                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SARI_02141
   00500 Starch and sucrose metabolism
    SARI_02141
Enzymes [BR:ses01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SARI_02141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2076625..2077908
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAAHYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
AYQGTVYIPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSIADWRRAVNPGGKYMPGKPAWY
MFDNCQSKRAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFSASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNIAKPWADAVISKRPFAGNTGTVDDKGEVQRNLNDTNYNRMWEYNNRGPGSK
VVTEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcaaatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgcccgattctgtcggcaaatgaagcgaaaaacttcgttgcggcgcactatttcgcc
tctctgacgccgaataccgcgccgtggtcgccgtcaccgattactttgcccgcgcagcct
gactttgtggtcggtccggcaggcacgcctggcgttacgcacacctcgattcaggccgcc
gtcgatgcggcaatggttaaacgcacgaataaacgccagtacatcgctattatgccgggc
gcctatcagggtaccgtctacattcccgccgcgccgggaagtctgacgctgtatgggaca
ggtgaaaaaccgatcgatgtaaaaatcggtatggcgattgatggtgaaatgagcatcgcc
gactggcgccgcgcggtgaatcccggagggaaatatatgccgggtaaacccgcgtggtat
atgttcgataactgccaaagcaaacgtgcagcaacgatcggcgtgatgtgttctgctgcg
ttctggtcgcaaaataacggactgcagctacaaaacctgaccatcgaaaacacgttgggc
gacagcgtcgatgccggaaaccatcctgcggtggcgctgcgtaccgatggcgataaggtc
cagattaacaaggtcaatatccttggccgtcagaataccttctttgtgaccaatagtggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtagatatggtttccggacgcggcgccgtggtgttcgataacactaacttc
caggtcgtcaactcccgcacgcaacaggaagcctacgtgttcgcccctgcgacgctatcc
aatatttactatggcttcctggcgatcaatagccgctttagcgcatccggcgatggcgtt
gcgcagcttggccgctcgctggatgttgacgccaacaccaacggccaggtggtgatccgc
gacagtgtgattaacgagggctttaacatcgccaaaccgtgggccgacgcggtcatctcg
aaacgtccgtttgccggaaatacgggaaccgtggatgacaaaggcgaggtgcagcgtaat
ctgaacgacactaactacaaccgcatgtgggaatacaacaaccgcgggccaggcagtaaa
gtggtaacggagcctaagcagtaa

DBGET integrated database retrieval system