KEGG   Salmonella enterica subsp. arizonae: SARI_02169Help
Entry
SARI_02169        CDS       T00627                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_02169 (galM)
   00052 Galactose metabolism
    SARI_02169 (galM)
Enzymes [BR:ses01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SARI_02169 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2104550..2105590
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNRAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
RYPEQTSFLGASIGRYANRIANSRYTFAGETVQLSPSQGENQLHGGPEGFDKRRWQIVNQ
NDRQVLFALTSDDGDQGFPGHLCATAQYRLTDDNRISITYRATVDKPCPVNLTNHVYFNL
DGDQTDVRQHKLQILADEYLPVDEYGIPRQGLKSVANTSFDFRMPKVIASEFLADDDQRK
VKGYDHAFLLQTQGDGKKPAARLWSQDGKLQMMVYTTAPALQFYSGNYLAGTPARGPEPY
ADWQGVALESELLPDSPNHPEWPQPDCILRPGEEYASLTEYQFIPF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaatgaaacacccgcactggcccccgatggtcagccgtaccgcctgttaaccctg
cgcaaccgcgcagggatggtggtaacgctgatggactggggagccactcttctttccgcc
cgtattccgctgtctgacggcagcgttcgggaggcattgctgggctgcgccagcccggaa
cgctatcctgaacagacgtcgttcctcggcgcctctattggccgttacgcgaaccgtatc
gctaatagccgttatacgtttgccggcgaaaccgtacagttaagcccaagccagggtgaa
aaccagctacacggcggaccggaaggctttgacaagcgccgctggcaaattgtaaatcag
aacgatcgccaggtattattcgcgctcacctctgatgacggcgaccagggctttcccggt
catctttgcgccacggcgcaatatcgtctgaccgatgataatcgaatttctatcacctac
cgggcgacggtcgataaaccctgtccggtgaatttgaccaaccacgtttattttaatctg
gacggcgatcagaccgacgtgcgtcaacacaagctgcaaattctggcggatgaatacctg
ccggtagatgaatacggtatcccacgtcagggactaaaatcggtggccaacacctcattt
gacttccggatgccaaaagtcatcgccagcgagtttctcgccgatgacgatcagcgcaaa
gttaaaggttacgatcatgcctttctgctacagacgcagggtgatggcaaaaagccggcg
gcccgtctgtggtcgcaggatggaaagctacaaatgatggtttacaccaccgccccggcg
ctacagttttattccggcaattatctggcaggcacgcctgcccgtgggccagaaccttat
gccgactggcaaggggtggcgctggaaagcgaactgctgccggacagcccgaatcatcct
gaatggccacagcctgactgtattcttcgccccggcgaggagtatgccagcctgaccgag
taccagtttattccgttctga

DBGET integrated database retrieval system