KEGG   Salmonella enterica subsp. arizonae: SARI_02174Help
Entry
SARI_02174        CDS       T00627                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_02174 (gpmA)
   01230 Biosynthesis of amino acids
    SARI_02174 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_02174 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SARI_02174 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SARI_02174 (gpmA)
Enzymes [BR:ses01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SARI_02174 (gpmA)
Exosome [BR:ses04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SARI_02174 (gpmA)
  Exosomal proteins of melanoma cells
   SARI_02174 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2110382..2111155
Genome map
AA seq 257 aa AA seqDB search
MSYRSESMAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFD
FAYTSVLKRAIHTLWNVLDELDQVWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVK
QWRRGFAVTPPELTKDDERYPGHDPRYAKLTDKELPTTESLALTIERVIPYWNESILPRM
KSGERVIIAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNA
DEIAAKAAAVANQGKAK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttataggagtgagagtatggctgtaactaagctggttctggtacgtcacggtgaa
agtcagtggaacaaagaaaaccgtttcactggctggtatgatgtggacctgtctgaaaaa
ggcgtaagcgaagcgaaagcggcaggtaagttattaaaagaagaaggtttcagctttgat
tttgcctacacctccgtactgaaacgcgctatccatacgctgtggaacgtactggatgaa
ctggatcaggtatggctgccagtggaaaaatcatggaaactcaatgaacgtcactatggc
gcgttgcaggggctgaataaagcggaaacggcagaaaaatatggcgacgagcaggttaaa
cagtggcgccgcggttttgccgttacgccgccggaattgaccaaagatgatgagcgctat
ccgggtcacgacccgcgctatgcgaagttgaccgataaagaactgccaacgaccgaaagc
ctggcgctaaccattgagcgcgttatcccttactggaacgaatccatcctgccgcgtatg
aaaagcggtgagcgcgtgatcatcgccgctcacggtaactcactgcgtgcgctggtgaaa
tacctggataacatgggtgaagatgaaattctggagctaaacatcccaaccggcgtgccc
ctggtgtatgagttcgacgagaacttcaaaccaatcaaacattactatttgggtaatgcc
gacgagatagcagcgaaagcggctgccgtggcgaatcaaggtaaagcgaagtaa

DBGET integrated database retrieval system