KEGG   Salmonella enterica subsp. arizonae: SARI_02210Help
Entry
SARI_02210        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00020  Citrate cycle (TCA cycle)
ses00640  Propanoate metabolism
ses00660  C5-Branched dibasic acid metabolism
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
Module
ses_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ses_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SARI_02210
   00640 Propanoate metabolism
    SARI_02210
   00660 C5-Branched dibasic acid metabolism
    SARI_02210
Enzymes [BR:ses01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SARI_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABX22082
UniProt: A9MJL9
Position
complement(2140672..2141838)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgttatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggcgcc
ggcccgtgggtagtgaaatgtcaggttcacgctgggggccgcggcaaagcgggcggtgtg
aaggtggtaaacagcaaagaggacattcgcgcctttgcggaaaactggctgggcaagcgt
ctggtgacctatcaaacagacgccaatggtcaaccggtcaaccagattctggttgaagcg
gcgactgatatcggcaaagagctgtatctcggcgcggtcgttgaccgtagttcccgtcgc
gtggtttttatggcctccaccgaaggcggcgtggaaattgagaaagtggcggaagaaacc
ccgcacctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgtgagctggcgtttaaactgggtctggaaggcaaactggtgcagcagttcaccaaaatc
ttcatgggcctggcgactatcttcctggagcgcgatctggcgcttatcgaaatcaacccg
ctggtcataaccaaacagggcgatctgatttgcctcgacggtaaactgggcgctgacggc
aacgcgctgttccgccagccggatctacgtgaaatgcgcgaccagtctcaggaagatccg
cgtgaagcgcaggcggcgcagtgggaactgaactatgtggcgctcgatggcaatatcggc
tgcatggtgaacggcgcaggtctggcgatgggcacgatggacatcgttaagctgcacggc
ggcgaaccagctaacttccttgacgttggcggcggcgcaaccaaagagcgtgtcaccgaa
gcgttcaaaatcatcctctctgatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtgcgctgtgatctgatcgctgacggtatcatcggcgcagtggaagaggtgggc
gttaatgtcccggttgtcgttcgtctggaaggcaacaacgccgaactcggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtcttacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system