KEGG   Salmonella enterica subsp. arizonae: SARI_02211Help
Entry
SARI_02211        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00020  Citrate cycle (TCA cycle)
ses00310  Lysine degradation
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
Module
ses_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ses_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SARI_02211
  Amino acid metabolism
   00310 Lysine degradation
    SARI_02211
Enzymes [BR:ses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SARI_02211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ABX22083
UniProt: A9MJM0
Position
complement(2141985..2143205)
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRITREDVEKHLAKAPAKDESKAPETAPAAQPALGARGEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYV
KAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKI
KELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAID
GKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcaaccgtc
gccacctggcataaaaaaccgggcgatgcggttgtccgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggactactgtaacctctcgccagatcctcggtcgcctgcgtgaaggc
aatagcgcgggtaaagagaccagcgcgaaatccgaagagaaagcgtctaccccggcacag
cgccagcaggcgtcgctggaagaacaaaacaatgatgcgctcagcccggcaatccgtcgc
ctactggctgaacacaatctggaagccagcgccattaaaggtactggcgtcggcggtcgt
attacccgtgaagatgtggaaaaacatctggcgaaagcgccagcgaaagacgagtctaaa
gcaccggaaaccgcgcctgccgcgcagccagcgcttggcgctcgcggggaaaaacgcgtg
ccgatgactcgcctgcgtaagcgtgtggccgagcgtctgctggaagcgaaaaactcaacc
gccatgctgacgacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcag
tacggcgaagtgtttgaaaaacgtcacggcatccgcctgggctttatgtccttctacgtg
aaagcggtggttgaagcgctgaagcgttatccagaagtgaacgcctctatcgacggcgat
gatgtggtgtaccacaactactttgatgtgagcatggcggtttctacgccgcgcggcctg
gtcacgccggtactgcgtgacgtggatacgctgggcatggctgatatcgagaagaaaatt
aaagaactggccgtcaaaggccgcgacggcaagttgactgtagaagatctgaccggcggt
aactttaccattaccaacggcggcgtatttggttcgctgatgtctaccccgatcatcaac
ccgccgcagagcgcgatcctgggaatgcacgccattaaagacaggccgatggcgatagac
ggcaaggtggaaattctgccgatgatgtacctggcgctttcttacgatcatcgcctgatc
gatggtcgcgaatccgtgggcttcctggtcactatcaaagagctgctggaagatccgacc
cgtctgctgctggacgtgtag

DBGET integrated database retrieval system