KEGG   Salmonella enterica subsp. arizonae: SARI_02427Help
Entry
SARI_02427        CDS       T00627                                 

Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SARI_02427
Enzymes [BR:ses01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SARI_02427
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SARI_02427
Lipid biosynthesis proteins [BR:ses01004]
 Fatty acid synthase
  Component type
   SARI_02427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2349452..2350036
Genome map
AA seq 194 aa AA seqDB search
MPFLFLFLLTFRVAAADTLLVLGDSLSAGYRMAANAAWPSLLNDKWQNQTPVVNASISGD
TSLQGLTRLPALLQQHQPRWVLVELGGNDGLRGFAPAQTEQTLRKIIQAVKAANAQPLLM
QIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMAKQLTPFLS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcctgtttttgttcctgttaaccttccgcgtcgccgccgcagacaccttatta
gttctgggcgatagccttagcgccggttaccgtatggctgccaacgcggcgtggccgtcg
ctgcttaatgataaatggcaaaaccaaacgccggtcgttaatgccagtataagcggtgat
acctcgctgcaggggctgacgcgtttgcctgcgctgttgcaacagcaccagccacgctgg
gtactggtggagcttggcggtaacgatggcctgcgtggctttgcgcctgcgcaaaccgaa
caaacgctacgtaaaatcatccaggcggtgaaagccgccaatgcccaaccgctattgatg
caaattcatctgcccgctaactatggtcgccgttataatgaatcctttagcgccatttat
cctaagctcgctaaagagttcgatattcctctgttaccgttttttatggaagaggtgtat
ctgaaaccccagtggatgcaggatgacggtattcatcccaaccgcgacgcccagccgttt
attgccgactggatggcgaagcagttgaccccttttctctcctga

DBGET integrated database retrieval system