KEGG   Salmonella enterica subsp. arizonae: SARI_02448Help
Entry
SARI_02448        CDS       T00627                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ses03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2371048..2371653)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMAEIGHCADC
RTFTEQEVCNICANPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLVSEKISELILATNPTVEGEATANYIAELCAQYGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgctgcgctgcctgccgggcgtt
ggcccgaagtcggcgcaacgaatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgcctggcgcaggcgctgaccagggcgatggcggaaatcggccactgcgccgactgt
cgcacctttaccgagcaggaagtctgtaatatctgcgccaaccctcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggacatctacgccattgagcagaccgggcaa
ttttccggacggtatttcgtgctgatggggcacctgtcgccgctggacggcatcgggccg
gacgatatcggtctcgatcgcctggaacagcgactggtgtcagaaaaaatcagcgagctg
atcctcgcgaccaacccaacggttgaaggggaagctactgcgaactatattgctgagctg
tgcgcgcagtatggcgtcgaggccagtcgtatcgcccacggcgtaccggttggcggcgag
ctggagatggtcgacggcacgacactgtcccactctctggcgggacgccacaagattatt
ttatga

DBGET integrated database retrieval system