KEGG   Salmonella enterica subsp. arizonae: SARI_02656Help
Entry
SARI_02656        CDS       T00627                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ses  Salmonella enterica subsp. arizonae
Brite
Enzymes [BR:ses01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SARI_02656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2580108..2580548)
Genome map
AA seq 146 aa AA seqDB search
MMQISSNGITRLKREEGERLKAYPDSRGIPTIGVGHTGKVDGNPVVSGMIITAEKSSELL
KEDLLWVEDAISSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAF
LLWKKAGKDPDILLPRRRRERALFLS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaatcagtagtaacggaatcaccagattaaagcgtgaagaaggcgagagacta
aaagcctatccagatagcagggggataccaaccattggggttggtcatacaggtaaagtg
gatggtaatcctgtcgtatcagggatgataatcacagccgaaaaatcgtctgaactgctt
aaagaggatttgctgtgggttgaagatgcgataagtagtcttgttcgcgtcccgctgaat
cagaaccagtatgatgcactatgtagcctgatattcaatataggtaaatcagcatttgct
ggctctaccgttctgcgccagttgaatttaaagaattaccaggcagcagcagatgctttc
ctgttatggaaaaaagctggtaaagaccctgatattctccttcctcggaggcggcgagaa
agagcgctgttcttatcgtga

DBGET integrated database retrieval system