KEGG   Salmonella enterica subsp. arizonae: SARI_02814Help
Entry
SARI_02814        CDS       T00627                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SARI_02814
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SARI_02814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2732370..2732849
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNQASPLEQVNAALKAIAGIPDSRIVAVSSFYRTPPLGPQNQPDYLNAAVA
LDTALTAEDLLNHTQRIELQQGRIRKAERWGPRTLDLDIMLFGDEVINTQRLTVPHYDMK
NRGFMLWPLFEIAPDLIFPDGLPLRQQLMLLAVEKPVAW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaaccaggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccggcattcccgatagccgtatcgtcgcggtctcttcgttt
taccgcacaccgccgcttggcccacagaatcagccagactatttaaatgccgccgtcgca
ctggatacggcgcttaccgcagaagacttgctgaatcatacccagcgtattgaactacag
cagggccgcatacgtaaagccgaacgctggggaccgcgaacgctggatctcgatattatg
ctgttcggtgatgaagtcattaatacccaacgtctgacggtgccgcactacgatatgaaa
aaccgtggctttatgctgtggccgctgtttgaaatcgctcccgatctgatttttccagac
ggactccccctaagacaacaactcatgcttctggctgtagaaaaacctgtcgcctggtaa

DBGET integrated database retrieval system