KEGG   Salmonella enterica subsp. arizonae: SARI_02841Help
Entry
SARI_02841        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00010  Glycolysis / Gluconeogenesis
ses00020  Citrate cycle (TCA cycle)
ses00620  Pyruvate metabolism
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
Module
ses_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_02841
   00020 Citrate cycle (TCA cycle)
    SARI_02841
   00620 Pyruvate metabolism
    SARI_02841
Enzymes [BR:ses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SARI_02841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ABX22688
UniProt: A9MQ89
Position
complement(2761762..2763642)
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSAEGAATAAPAPAEEKKEAAPAAAPAAAAAKEVHVPDIGGDEVEV
TEVMVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFDVA
GEAGAAAPAKAEAATTPAATGKKDVNVPDIGGDEVEVTEVMVKVGDKVEAEQSLITVEGD
KASMEVPAPFAGTVKEIKISIGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPAAKAE
KPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGSGRKGRILREDVQAY
VKEAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSLSED
GQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHR
VIDGADGARFITIINNMLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggcagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaggtctct
gtcggcgacaaaaccgagactggcaaactgattatgattttcgattccgccgaaggtgca
gcaactgctgcgcctgctccggcagaagagaagaaagaagcggctccggcggcagcacct
gctgcggcagcggcgaaagaagtacacgtaccggatatcggcggcgacgaagtcgaagtg
accgaagtgatggtgaaagtcggcgataaagtggaagctgaacagtcgctgatcaccgta
gaaggtgataaagcctctatggaagttccggcgccgttcgcgggcaccgtgaaagagatc
aaaattaacaccggcgacaaagtgtctaccggttcgctgatcatggtcttcgacgttgca
ggtgaagcgggtgcagcagcaccggcgaaagcggaagccgctacgacgccagcagccact
ggcaagaaagacgttaacgtaccggatatcggcggcgacgaagttgaagttaccgaagtg
atggtgaaagtcggcgataaagtggaagctgaacagtcgctgatcaccgtagaaggcgac
aaggcttctatggaagttccggcaccgttcgcgggcaccgtgaaagagatcaaaatcagc
atcggcgacaaagtgaaaaccggttctctgattatggtcttcgaagtggaaggcgcagcg
cctgctgccgctccggctaaacaggaagcggctgcccccgcgccagcggcaaaagctgag
aaacctgctgcggcgccggctgccaaagcggaaggcaaatccgaatttgctgagaacgac
gcttacgttcacgcgacgccgctgattcgccgcctggcacgcgaattcggcgtgaacctg
gcgaaagtgaaaggctctggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttac
gtaaaagaggctatcaagcgtgcggaagctgcaccggcagcagcaggcggcggtattcca
ggcatgttgccgtggccgaaagtggacttcagtaagtttggtgaagttgaagaagtggaa
ctgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtgatgatcccg
cacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgtaaacaacag
aacgccgaagctgagaagcgcaaactggatgtgaaatacaccccggttgtcttcatcatg
aaagcggttgccgctgcgcttgagcagatgccgcgcttcaatagctctttgtccgaagat
ggtcagcgcctgacgctgaagaaatacatcaacatcggcgtggcggttgatacgccaaat
ggtctggtggttccagtctttaaagacgtgaataagaagagtgtgactgagctgtctcgc
gaactgactaccatctccaaaaaagcgcgtgatggtaagcttaccgctggcgaaatgcag
ggcggttgcttcactatctccagtatcggcggcctgggaactacccacttcgcgccgatt
gtcaacgcgccggaagtggctatcctcggcgtgtccaagtcggcgatggaaccggtgtgg
aatggtaaagagtttgtgccgcgtctgatgatgcctatctctctctccttcgaccaccgt
gtgatcgacggtgctgatggtgcgcgtttcattaccattatcaacaatatgctgtctgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system