KEGG   Salmonella enterica subsp. arizonae: SARI_02988Help
Entry
SARI_02988        CDS       T00627                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SARI_02988
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SARI_02988
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SARI_02988
Enzymes [BR:ses01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SARI_02988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2920570..2921856)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQEILEERIRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTTLGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLSVKRFIAATNVNDTVPRFLRDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKVWRLTELGYAAIDDATTQQTMCELKAKGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPANFAAL
RKLMMARQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caaggactgggcaaacagcaaggactttttttcccacacgacctgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcaggagattttggaagagcgcatccgcgcggcgttt
gctttcccggcgccggtcgcgcaggtggaaagcgatgtcggttgcctggagttattccac
ggcccgacgctggcgtttaaagatttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgaccgcaacgtcaggcgatactggcgcagcg
gttgctcacgcgttctatggtctggaaaatgtgcgggtcgtcattctctatccgcgcggc
aagatcagcccgttgcaggaaaaactgttctgtacgctgggtggtaacattgaaactgtt
gcgatcgacggcgattttgatgcttgtcaggcgctggtgaaacaggcatttgatgatgaa
gagctgaaaacgacgctggggctgaattcggctaactctattaatatcagccgcctgctg
gcgcaaatttgctactactttgaagcggtggcgcaattgccccagggggcgcgtaaccaa
ctggtgatctccgtacccagcggtaactttggtgatttgacggcagggctgctggcgaag
tcgctagggctgtcggtgaaacgttttatcgccgccactaacgtcaacgacacggtaccg
cgtttcctgcgtgacgggaagtgggcgccaaaagcgacgcaggcgactctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgcgtggaggagctgttccgccgtaaggtc
tggcgtctgactgagctgggctatgcggcgatagatgacgccacgacacaacagacgatg
tgcgagttgaaagcgaaaggctatacctcggagcctcatgcggcggtggcgtatcgggca
ttgcgtgaccagctaaacccgggtgagtatggcttgttcctcggaacggcgcatccggcg
aagtttaaagagagcgtggagtccattctgggagaaacgctggccttgcctgaagcgctc
gccgaacgcgccgatctgccgctgctttcacatcatctgcctgcgaattttgccgcgcta
cgtaagctgatgatggcccgccaataa

DBGET integrated database retrieval system