KEGG   Salmonella enterica subsp. arizonae: SARI_03010Help
Entry
SARI_03010        CDS       T00627                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ses00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2943783..2945105)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHTLSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKNLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIQDVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNALEVREAVQFLTGEYRNPRLFDVTMALCIEMLISGQLAKDDAQARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYDKYLPAAMLSKAVYADTEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMVRLGDSVDGQRPLAVIHAKDEANWQEAAKAVKAA
IILDDKAPASTPSIYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgacggtcatacgctgagcgatgaa
gaaattcgcttctttatcaacggcattcgtgacaacactatctcggaaggacagattgcc
gcgctggcgatgaccattttcttccacgatatgaccatgccggaacgcgtttcgctgacc
atggcgatgcgggattcaggtaccgttctcgactggaagaatctgaatcttaatggcccg
attgtcgataagcactcgaccggcggcgtgggggatgtgacgtccctgatgctggggcca
atggtagcagcctgcggcggttatgtgccgatgatctctggtcgaggcctcggacacact
ggcggtacgctggacaaactggaagcgattcctggcttcgatatcttcccggacgacaac
cgtttccgcgacattattcaagacgtgggagtggcgattattgggcagaccaactcgctt
gcgccagcggacaaacgcttttacgccacccgcgatattaccgcgacggtggactctatc
ccactgattaccggttccattctcgccaaaaaactggccgaagggctggatgcgctggtg
atggacgtaaaagtcggcagcggcgcgtttatgccgacctatgaactctccgaagcgttg
gctgaagcgattgtcggcgtggcgaacggcgcgggggttcgcactacggcgctgttaact
gatatgaaccaggtgctggcgtccagcgccggtaacgcgctagaagtgcgcgaagcggtg
cagttcctcaccggcgagtaccgtaatccgcgcttgtttgacgtcaccatggcgctatgc
attgagatgttgatctccggtcagcttgctaaagatgatgcgcaagcgcgggcgaaatta
caggcggtgctggataacggcaaagcggcagaggtttttggccgcatggtggcagcccag
aaaggcccgactgatttcgttgagaactacgataaatacctgcccgccgccatgttgagc
aaagcggtatatgcagataccgaagggtttgttagcgcgatggatacgcgagcgctgggt
atggcggtggtctcgatgggcggcggtcgtcgtcaggcatcggacacgattgactatagc
gtgggctttaccgacatggttcgtctgggcgacagtgttgatggacagcgcccgctggcg
gtgattcatgccaaagacgaagctaactggcaggaagcggcgaaggccgtcaaagcggca
attatccttgacgataaagcgccagcaagcacaccttcgatctatcgtcgtattactgaa
tag

DBGET integrated database retrieval system