KEGG   Salmonella enterica subsp. arizonae: SARI_03167Help
Entry
SARI_03167        CDS       T00627                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SARI_03167
   00240 Pyrimidine metabolism
    SARI_03167
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SARI_03167
   03430 Mismatch repair
    SARI_03167
   03440 Homologous recombination
    SARI_03167
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SARI_03167
DNA replication proteins [BR:ses03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SARI_03167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3086099..3086542
Genome map
AA seq 147 aa AA seqDB search
MKNATFYILDNDTAVDGLSAVEQLVCDIAAERWRSGKRVLIACEDEQQAIRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTNFADFATAFTEVVDFVPYE
ETLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgcgaccttttatattctggacaatgacaccgccgtcgacggtttaagcgcc
gttgaacaactggtgtgtgatattgccgcagaacgttggcgcagcggcaagcgcgtgctg
atcgcctgtgaagacgagcagcaggccattcgactggatgaagcgctgtgggcgagacct
gcggaaagttttgtcccgcacaatctggcaggcgaaggcccacgcggcggcgcgccggtc
gaaatcgcctggccgcaaaaacgcaacagcagcccgcgcgatattttaatcagcctgcgt
acaaactttgcagattttgccaccgctttcacagaagtggtagacttcgtcccttacgaa
gaaactttgaaacaactggcgcgcgaacgctacaaagcctaccgcgtggctggttttaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system