KEGG   Salmonella enterica subsp. arizonae: SARI_03472Help
Entry
SARI_03472        CDS       T00627                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_03472
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SARI_03472
Enzymes [BR:ses01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SARI_03472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3405450..3406769)
Genome map
AA seq 439 aa AA seqDB search
MEHLYMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGEAKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDQYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGASSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatttgtacatgaaaactcgtactcaacaaatcgaagaattacagaaagagtgg
acacaaccgcgctgggaaggcattacccgcccgtacagcgcggaggacgtggtgaaatta
cgcggctcggttaacccggaatgtacgctggcgcaactcggcgccgcgaaaatgtggcgt
ctgctgcacggcgaagcgaaaaaaggctatatcaacagtcttggcgcgctgaccggcggc
caggcgctgcaacaggcgaaagccggcattgaggccgtctatctctccggctggcaggtc
gcggcggatgctaacctcgcgtccagcatgtatccggatcaatcgttgtacccggcgaac
tctgttccggcggtggtggatcggatcaacaatactttccgccgcgcggatcagatccag
tgggcgtccggcattgagcccaacgatccgcgctatgtggattactttctgccgatcgtt
gctgatgcggaagcgggatttggcggcgtactgaacgcatttgagttgatgaaatcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctagcgtcggtgaagaagtgc
gggcatatgggcggtaaagtgctggtgccgacgcaagaagcgatccagaaactggtggcg
gcacgtctggcggcagacgtgatgggcgttccaacgctggtgattgctcgtactgatgcg
gatgcggcggatttgattacttccgattgcgatcaatacgatagcgaatttattaccggc
gaacgcaccagcgaaggtttcttccgtactcatgcggggattgaacaggctatcagtcgt
ggtctggcttatgcgccttatgcagacctggtgtggtgcgaaacgtccacgccggatctt
gagctggcgaagcgttttgctgatgctatccacgcgaagtatccgggcaaactgctggcc
tacaactgttcgccgtccttcaactggcagaagaatctggacgataaaactatcgccagc
ttccagcagcagttatcggatatgggctacaagtaccagttcatcaccctggcggggatt
cacagcatgtggttcaacatgttcgatctggcgcacgcttatgctcagggcgagggcatg
aagcactatgtcgagaaagttcagcagccggagtttgccgcagcgaaagacggttatacc
ttcgtctcacatcagcaggaagtgggcaccggttacttcgacaaggtcaccactatcatt
caggggggcgcttcttcagtcaccgcactgacgggctccacggaagaatcgcagttttga

DBGET integrated database retrieval system