KEGG   Salmonella enterica subsp. arizonae: SARI_03473Help
Entry
SARI_03473        CDS       T00627                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_03473
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SARI_03473
   00630 Glyoxylate and dicarboxylate metabolism
    SARI_03473
Enzymes [BR:ses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SARI_03473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3406786..3408387)
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPPGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIREGNWQIRGIPEDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWDKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILYALRDHIVGLNCGRWDYIFSYIKTLKNHPERVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNAQVLNKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAKQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKTLFR
EMLAEEMRVIQDELGEHRYSKGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaaccgatgaattgacctttaccaggccgccaggcgagctg
gaaaagcaggtcctgaccgctgaggcagtcgagtttctgacggaattagtcacacgtttt
acgccaaagcggaataaactcctggctgcacgtattcagcagcagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagagggtaattggcagatt
cgtggtattccggaggatttacaggaccgccgggtggaaattaccggaccggttgaacgt
aaaatggtgatcaatgccctgaacgcgaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactgggataaagttattgatggtcaaatcaacctgcgcgatgcggtt
aatggcaccattagctataccaacgaagccggaaaaatatatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgcggtctgcatctgcctgaaaaacatgttacctggcgt
ggcgaagcgattcccggcagtctgtttgattttgctctgtactttttccacaactataaa
gcgttgctcgccaaaggtagcggcccatacttctacctgccaaaaacgcaagcctggcag
gaggccgcctggtggagcgaagtcttcagctatgccgaagaccgtttcaacctgccgcgc
ggcacgatcaaagctaccctgttgattgaaaccctgcctgctgttttccagatggatgaa
attctttatgcgttgcgtgaccacattgtgggcctcaactgtggtcgctgggattatatc
ttcagctatatcaaaacgttgaaaaatcacccggagcgcgttctgccggacaggcaggtg
gtaacgatggacaaaccgttcctgagcgcctactcgcgcctgctgatcaaaacctgccac
aagcgcggcgccttcgcgatgggtggtatggcggcgtttatcccaagtaaagacgctgaa
cgcaatgcgcaagtgctgaacaaggtgaaagcggataaagcgctggaagctaacaacggt
catgacggtacgtggattgcgcatcccggccttgcggataccgcgatggcagtctttaac
gaggtactgggcgagcacaaaaatcagctattcattactcgcgatgaagatgcgccgatt
accgctaagcagttactggaaccatgtgaaggtgaacggacagaagcgggaatgcgcgcc
aatattcgcgtcgcggtgcagtacattgaagcgtggatctctggcaatggctgcgtaccg
atttatggcctgatggaagatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcatcatgagaaaacgctgagtaatggaaaacctgtaacaaaaacgcttttccgc
gaaatgctggcggaagagatgcgagtaatccaggacgagctgggcgagcaccgctacagc
aaagggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgactta
atcgacttcctcaccctgccgggttatcgcttactggcttaa

DBGET integrated database retrieval system