KEGG   Salmonella enterica subsp. arizonae: SARI_03576Help
Entry
SARI_03576        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_03576
   01230 Biosynthesis of amino acids
    SARI_03576
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_03576
   00051 Fructose and mannose metabolism
    SARI_03576
   00562 Inositol phosphate metabolism
    SARI_03576
Enzymes [BR:ses01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SARI_03576
Exosome [BR:ses04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SARI_03576
  Exosomal proteins of bladder cancer cells
   SARI_03576
  Exosomal proteins of melanoma cells
   SARI_03576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3511007..3511756
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELAGVAGCDVAIAPPEMYIDLAKRAAAGSHIMLGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggtggctaacctg
cgtaaagaactggcgggcgtagcaggctgcgacgtggcaatcgctccgccggaaatgtat
atcgacctggcgaaacgcgctgctgccggtagccacatcatgctgggcgcgcagaacgtt
gacctgaacctgtccggcgcattcaccggtgaaacttcggctgaaatgctgaaagatatc
ggcgcgcagtacattattatcggccactccgagcgtcgtacttatcacaaagaatctgac
gagctgatcgccaaaaaattcgccgtgctgaaagaacaaggtctgacgccggtactgtgc
atcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaagaagtgtgcgcacgccag
atcgacgcggtactgaaaacgcagggcgcggcggcctttgaaggcgcggttatcgcttac
gaacccgtatgggcgatcggcaccggtaaatctgctaccccggctcaggcgcaggcggta
cacaaattcatccgcgaccacattgccaaagctgacgctaaaatcgctgagcaggtcatt
atccagtacggcggttccgtcaacgcgtccaacgcagccgaactgttcgcgcagccggac
atcgacggcgcgctggtaggcggcgcttctctgaaagctgacgccttcgccgtgatcgtg
aaagcagccgaagccgctaaacaggcttaa

DBGET integrated database retrieval system