KEGG   Salmonella enterica subsp. arizonae: SARI_03581Help
Entry
SARI_03581        CDS       T00627                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_03581
   01230 Biosynthesis of amino acids
    SARI_03581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_03581
   00030 Pentose phosphate pathway
    SARI_03581
   00051 Fructose and mannose metabolism
    SARI_03581
   00052 Galactose metabolism
    SARI_03581
  Energy metabolism
   00680 Methane metabolism
    SARI_03581
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SARI_03581
Protein phosphatases and associated proteins [BR:ses01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SARI_03581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3516764..3517726)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggcgttgtgcgcgcagcgttgacggaagggctggaagtcatgggaatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgatcgttatagcgtatctgac
atgatcaaccgtggcggtacttttcttggctcggcgcgttttccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggcatcgatgcgctggttgtg
attggcggcgacggttcttatatgggggcaaaacgtctgactgaaatgggtttcccatgc
atcggcctgccgggcactattgataacgatatcaaaggtaccgactacactatcggctat
ttcaccgctctgggcaccgtggtggaagcgattgaccgtctgcgtgatacttcctcttct
caccaacgtatctctattgttgaagtgatgggacgttattgcggtgacctgactctggcg
gcggccattgcgggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggcggaaatcaaagccggtatcgcgaaaggtaaaaaacatgccatcgttgct
atcactgaacatatgtgcgatgttgacgagctggcgcactttattgaaaaagaaacgggt
cgtgaaacgcgtgcgacggtgctgggccacatccagcgcggcggttctcccgtaccttac
gatcgcattctggcttcccgtatgggcgcttatgctattgacctgctgctggaaggccac
ggcggtcgttgtgtcggtatccagaacgaacagcttgttcatcatgacatcattgatgca
attgaaaacatgaagcgtccgttcaaaagtgactggatggagtgcgcgaaaaaactgtac
taa

DBGET integrated database retrieval system