KEGG   Salmonella enterica subsp. arizonae: SARI_03603Help
Entry
SARI_03603        CDS       T00627                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ses01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ses00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ses00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ses00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ses00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ses00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3536661..3537815
Genome map
AA seq 384 aa AA seqDB search
MFMSFMLALPKISLHGAGAIGDMVKLIANKQWGKALIVTDSQLVKLGLLDNLFSALDAHN
MHYHLFDKVFPNPTEALVQKGYAAYQAEACDYIIAFGGGSPIDTAKAVKILTANPGPSTA
YSGVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDTERQVKEVIIDPNIIPDIAVDDASV
MLEIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAVRLINLWLPKAVDDGHNLEA
REQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVAR
FARLAQAMGVDTRGMSDEAASQEAINAIRALSKRVGIPEGFSQLGVTKDDIEGWLDKALA
DPCAPCNPRTASRDEVRELYLEAL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgagctttatgttggcattgccgaaaatcagtctgcacggcgcaggggctatt
ggcgatatggtcaagctgatcgccaataagcaatggggtaaggcgctgatcgtcaccgac
agtcaactggtcaaactcggcctgttagacaatctgttcagcgctctggatgcgcataac
atgcattatcatttgtttgataaagtgttcccgaaccccaccgaagcccttgtgcaaaaa
ggctatgcggcgtaccaggcggaagcctgtgattacatcatcgccttcggcggcggcagc
ccgatcgacaccgcgaaggcagtgaaaatcctcaccgccaatccaggcccttccaccgcc
tactccggcgtcggcaaagtgaaaaacgccggcgtaccgctggtggcgattaacactacg
gcaggcaccgcggcggaaatgaccagcaatgcggttatcatcgacaccgagcgtcaggta
aaagaagtcattatcgatccaaacatcatcccggatatcgcggtggacgacgccagcgta
atgctggaaatccccgcttctgtaaccgccgcgaccggtatggatgcgctcacccacgcg
gtagaagcctacgtatctgtcggcgcgcatccgctcaccgatgctaacgcgttagaagcg
gttcggctgattaacctgtggctaccgaaagcggttgatgatggtcataaccttgaagcg
cgtgagcagatggcattcggccagtatctggcaggcatggcgttcaacagcgccggactt
gggctggttcacgctctggcgcaccagccgggcgcaacccacaacctaccgcacggcgtc
tgcaacgctattctgctgccaattatcgagaactttaaccgtccgaacgccgtggcgcgt
tttgcccgcctcgcgcaggcaatgggcgtagatacgcgtggtatgtctgacgaagccgca
agccaggaagcgatcaacgccatccgcgcgttaagcaaacgcgtcggtattccggaaggt
tttagtcagttgggagtgacgaaagacgatatcgaaggctggctggataaagcgttagct
gacccatgtgcgccgtgtaacccgcgcaccgccagccgcgacgaagtgcgtgagctgtac
ctggaggcattatga

DBGET integrated database retrieval system